Search results

From Proteopedia

You searched for 1w68.gif

Jump to: navigation, search

There is no page with the exact title "1w68.gif". The search results for "1w68.gif" are displayed below. You can create a page titled 1w68.gif (by clicking on the red link).

For more information about searching Proteopedia, see Help.

Showing below 4 results starting with #1.


View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

Article title matches

  1. 1w68 (5,000 bytes)
    3: ...ion load='1w68' size='340' side='right'caption='[[1w68]], [[Resolution|resolution]] 2.20Å' scene='...
    5: ...</b> use [https://proteopedia.org/fgij/fg.htm?mol=1W68 FirstGlance]. <br>
    8: ...https://prosat.h-its.org/prosat/prosatexe?pdbcode=1w68 ProSAT]</span></td></tr>
    13: [[Image:Consurf_key_small.gif|200px|right]]
    16: ...rf_initial_scene = true; script "/wiki/ConSurf/w6/1w68_consurf.spt"</scriptWhenChecked>

Page text matches

  1. 1w68 (5,000 bytes)
    3: ...ion load='1w68' size='340' side='right'caption='[[1w68]], [[Resolution|resolution]] 2.20&Aring;' scene='...
    5: ...</b> use [https://proteopedia.org/fgij/fg.htm?mol=1W68 FirstGlance]. <br>
    8: ...https://prosat.h-its.org/prosat/prosatexe?pdbcode=1w68 ProSAT]</span></td></tr>
    13: [[Image:Consurf_key_small.gif|200px|right]]
    16: ...rf_initial_scene = true; script "/wiki/ConSurf/w6/1w68_consurf.spt"</scriptWhenChecked>
  2. Mouse Ribonucleotide Reductase R2 (4,160 bytes)
    1: ...onucleotide Reductase R2 containing oxo-diiron, [[1w68]]' scene=''>
    10: <scene name='Sandbox_46/1w68/2'>1w68 (under oxidizing conditions)</scene>:
    19: For the enzyme under oxidizing conditions ([[1w68]]):
    23: KKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA
    31: KKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA
  3. Ribonucleotide reductase 3D structures (8,717 bytes)
    40: **[[1w68]], [[1h0n]], [[1h0o]], [[1xsm]] – mRNR R2 – m...

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)



Search in namespaces:

List redirects
Search for
Views
Personal tools