Search results

From Proteopedia

You searched for 1w69.gif

Jump to: navigation, search

There is no page with the exact title "1w69.gif". The search results for "1w69.gif" are displayed below. You can create a page titled 1w69.gif (by clicking on the red link).

For more information about searching Proteopedia, see Help.

Showing below 4 results starting with #1.


View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

Article title matches

  1. 1w69 (5,068 bytes)
    3: ...ion load='1w69' size='340' side='right'caption='[[1w69]], [[Resolution|resolution]] 2.20Å' scene='...
    5: ...</b> use [https://proteopedia.org/fgij/fg.htm?mol=1W69 FirstGlance]. <br>
    8: ...https://prosat.h-its.org/prosat/prosatexe?pdbcode=1w69 ProSAT]</span></td></tr>
    13: [[Image:Consurf_key_small.gif|200px|right]]
    16: ...rf_initial_scene = true; script "/wiki/ConSurf/w6/1w69_consurf.spt"</scriptWhenChecked>

Page text matches

  1. 1w69 (5,068 bytes)
    3: ...ion load='1w69' size='340' side='right'caption='[[1w69]], [[Resolution|resolution]] 2.20&Aring;' scene='...
    5: ...</b> use [https://proteopedia.org/fgij/fg.htm?mol=1W69 FirstGlance]. <br>
    8: ...https://prosat.h-its.org/prosat/prosatexe?pdbcode=1w69 ProSAT]</span></td></tr>
    13: [[Image:Consurf_key_small.gif|200px|right]]
    16: ...rf_initial_scene = true; script "/wiki/ConSurf/w6/1w69_consurf.spt"</scriptWhenChecked>
  2. Mouse Ribonucleotide Reductase R2 (4,160 bytes)
    14: <scene name='Sandbox_46/1w69/2'>1w69 (under reducing conditions)</scene>:
    23: KKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA
    27: For the enzyme under reducing conditions([[1w69]]):
    31: KKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA
  3. Ribonucleotide reductase 3D structures (8,717 bytes)
    72: **[[1w69]] – mRNR R2 + acetate<br />

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)



Search in namespaces:

List redirects
Search for
Views
Personal tools