File list
From Proteopedia
 Date |
Name | User | Size | Description |
|---|---|---|---|---|
| 05:03, 20 October 2024 | 7beq_monomer.pdb (file) | Joel L. Sussman | 117 KB | |
| 08:12, 16 October 2024 | 005_Fig_07b_with_Arrow.pse (file) | Joel L. Sussman | 4.07 MB | |
| 19:59, 13 October 2024 | 005_Fig_7a_smaller.pse (file) | Joel L. Sussman | 1.04 MB | |
| 19:56, 13 October 2024 | Fig_07a.pngj (file) | Joel L. Sussman | 305 KB | |
| 19:04, 13 October 2024 | PngjFig_07a.pngj (file) | Joel L. Sussman | 305 KB | |
| 18:52, 13 October 2024 | MyFile.png (file) | Joel L. Sussman | 305 KB | |
| 18:13, 13 October 2024 | Fig_7a_smaller.spt (file) | Joel L. Sussman | 9 KB | |
| 17:58, 13 October 2024 | 005_Fig_7a.pse (file) | Joel L. Sussman | 7.64 MB | |
| 06:31, 10 October 2024 | 8XH0_rot.pdb (file) | Joel L. Sussman | 390 KB | |
| 05:17, 10 October 2024 | FLIC_and_Bovine_TLR5.pdb (file) | P. Sadashiv Pooja | 943 KB | |
| 19:54, 9 October 2024 | 8xh2a_8xh2b_rot.pdb (file) | Joel L. Sussman | 613 KB | |
| 11:18, 9 October 2024 | New-look-buttons-models.png (file) | Angel Herraez | 13 KB | (switches for multi-model files) |
| 06:52, 9 October 2024 | 8xh1a_8xh1b_rot.pdb (file) | Joel L. Sussman | 613 KB | |
| 14:58, 8 October 2024 | 8xh1b_rot.pdb (file) | Joel L. Sussman | 287 KB | |
| 13:23, 8 October 2024 | 8XH1a.pdb (file) | Joel L. Sussman | 327 KB | |
| 18:02, 25 September 2024 | New-look-buttons.png (file) | Angel Herraez | 64 KB | (Buttons under the JSmol panel. Before and after restyling on Sept. 2024) |
| 13:48, 24 September 2024 | Mioglobin.pdb (file) | 97 KB | (predicted from MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG) | |
| 02:57, 23 September 2024 | D4b7fdf509a302dceae6262d8ae945d9.pdb (file) | 10 KB | (predicted from HAPPYNEWYEAR) | |
| 20:11, 22 September 2024 | D33bba2f2830061a2b6c58c3909b3fc6.pdb (file) | 10 KB | (predicted from REPREPVKIREP) | |
| 16:52, 22 September 2024 | 34c47d4b4a5fa7021b8f2d2929128f36.pdb (file) | 5 KB | (predicted from VKSIRI) | |
| 14:59, 22 September 2024 | Serum_amyloid_A-1.pdb (file) | 77 KB | (predicted from MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY) | |
| 10:56, 15 September 2024 | 4153f01779633cd251a4a69f78c3069c.pdb (file) | 4 KB | (predicted from VKSI) | |
| 10:07, 10 September 2024 | UPL8H1D.pdb (file) | Jaime Prilusky | 2.64 MB | |
| 10:05, 10 September 2024 | 8h1d.pdb (file) | Jaime Prilusky | 2.64 MB | (same file at PDBe) |
| 11:17, 3 September 2024 | Try_4.pse (file) | Joel L. Sussman | 782 KB | |
| 11:05, 3 September 2024 | Try_3.pse (file) | Joel L. Sussman | 808 KB | |
| 10:59, 3 September 2024 | Fig_05b_try_2.pse (file) | Joel L. Sussman | 808 KB | |
| 08:45, 3 September 2024 | Fig_6b_try_2.pse (file) | Joel L. Sussman | 808 KB | |
| 08:35, 3 September 2024 | Fig_6b.pse (file) | Joel L. Sussman | 808 KB | |
| 06:54, 3 September 2024 | 8XH1.pdb (file) | Joel L. Sussman | 656 KB | |
| 19:44, 2 September 2024 | Lactase_reaction.PNG (file) | Karsten Theis | 109 KB | (Lactose is hydrolized to glucose and galactose) |
| 10:08, 1 September 2024 | 8xh0_CA_packing.pse (file) | Joel L. Sussman | 516 KB | |
| 14:41, 31 August 2024 | Tertiary_interactions2.png (file) | Karsten Theis | 148 KB | |
| 14:09, 31 August 2024 | Tertiary_interactions.png (file) | Karsten Theis | 483 KB | |
| 07:02, 31 August 2024 | 8XH0-2.pngj (file) | Joel L. Sussman | 540 KB | |
| 07:49, 30 August 2024 | 8XH0.pdb (file) | Joel L. Sussman | 379 KB | |
| 03:35, 28 August 2024 | 4ioa-epm.gif (file) | Eric Martz | 10.21 MB | |
| 17:08, 27 August 2024 | 1bl8ABC-cap2-trimmed.gif (file) | Eric Martz | 9.75 MB | |
| 16:55, 27 August 2024 | 5t01-epm-protein.png (file) | Eric Martz | 50 KB | |
| 16:52, 27 August 2024 | 5t01-epm-dna.png (file) | Eric Martz | 39 KB | |
| 19:59, 25 August 2024 | 1pgb-EPM-iCn3D.png (file) | Eric Martz | 204 KB | |
| 18:10, 25 August 2024 | 1pgb-charge-fgij.png (file) | Eric Martz | 130 KB | |
| 17:18, 25 August 2024 | 1pgb-EPM-PyMOL.png (file) | Eric Martz | 99 KB | |
| 14:36, 25 August 2024 | Secondary_structure_OpenStax.jpg (file) | Karsten Theis | 277 KB | (Schematic of alpha helix and beta sheet, from OpenStax Biology 2e, ISBN-13: 978-1-947172-52-4.) |
| 13:59, 25 August 2024 | Peptide_bond.jpg (file) | Karsten Theis | 73 KB | (Net reaction of peptide bond formation, from OpenStax Biology 2e, ISBN-13: 978-1-947172-52-4.) |
| 12:14, 19 August 2024 | 8ov1_8ov2_8vo3.pdb (file) | Joel L. Sussman | 325 KB | |
| 11:30, 19 August 2024 | PR10-10_C59S_papaverine_8vo3.cif (file) | Joel L. Sussman | 123 KB | |
| 11:27, 19 August 2024 | PR10-10_C59S_8vo2.cif (file) | Joel L. Sussman | 114 KB | |
| 11:23, 19 August 2024 | PR10-10_C155S_8ov1.cif (file) | Joel L. Sussman | 109 KB | |
| 20:17, 18 August 2024 | Altloc-anim-cartoon-5sop.gif (file) | Eric Martz | 1.13 MB |
 First page |
 Previous page |
 Next page |
 Last page |
