Sandbox chameleon
From Proteopedia
(Difference between revisions)
| Line 7: | Line 7: | ||
Display this IgG-Binding domain in <scene name='61/611439/Rainbow_cartoon/1'>Rainbow Ribbon</scene> | Display this IgG-Binding domain in <scene name='61/611439/Rainbow_cartoon/1'>Rainbow Ribbon</scene> | ||
''i.e.'' going from Blue---Red from N--->C terminal. Simply things with all coloured in <scene name='61/611439/Cartoon_beige/1'>beige</scene> | ''i.e.'' going from Blue---Red from N--->C terminal. Simply things with all coloured in <scene name='61/611439/Cartoon_beige/1'>beige</scene> | ||
| - | Now display the structure mutated structure where 5 amino acids, in region <scene name='61/611439/Cartoon_pink_23-33/1'>23-33</scene>, were change | + | Now display the structure mutated structure where 5 amino acids, in this region <scene name='61/611439/Cartoon_pink_23-33/1'>23-33</scene>, were change to the Chameleon sequence, i.e. '''AWTVEKAFKTF''' |
i.e. going from: | i.e. going from: | ||
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK | TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK | ||
TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK | TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK | ||
| + | |||
| + | |||
Revision as of 15:58, 30 November 2014
Your Heading Here (maybe something like 'Structure')
| |||||||||||
References
- ↑ Hanson, R. M., Prilusky, J., Renjian, Z., Nakane, T. and Sussman, J. L. (2013), JSmol and the Next-Generation Web-Based Representation of 3D Molecular Structure as Applied to Proteopedia. Isr. J. Chem., 53:207-216. doi:http://dx.doi.org/10.1002/ijch.201300024
- ↑ Herraez A. Biomolecules in the computer: Jmol to the rescue. Biochem Mol Biol Educ. 2006 Jul;34(4):255-61. doi: 10.1002/bmb.2006.494034042644. PMID:21638687 doi:10.1002/bmb.2006.494034042644
