Sandbox chameleon
From Proteopedia
(Difference between revisions)
| Line 1: | Line 1: | ||
| - | == | + | ==Does the amino acid sequence ''really'' determine the 3D structure of a peptide?')== |
<StructureSection load='2gb1' size='340' side='right' caption='2gb1' scene='61/611439/Rainbow_cartoon/1'> | <StructureSection load='2gb1' size='340' side='right' caption='2gb1' scene='61/611439/Rainbow_cartoon/1'> | ||
General question: To determine the extent to which non-local factors influence the formation of secondary structural elements | General question: To determine the extent to which non-local factors influence the formation of secondary structural elements | ||
Revision as of 16:12, 30 November 2014
Does the amino acid sequence really determine the 3D structure of a peptide?')
| |||||||||||
i.e. going from:
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGAWTVEKAFKTFTVTEK
</StructureSection>
References
- ↑ Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
- ↑ Zhou X, Alber F, Folkers G, Gonnet GH, Chelvanayagam G. An analysis of the helix-to-strand transition between peptides with identical sequence. Proteins. 2000 Nov 1;41(2):248-56. PMID:10966577
