Sandbox chameleon

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 16: Line 16:
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK
TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK
 +
If a similar change from the Wild-Type to 5 amino acids, in the region <scene name='61/611439/Cartoon_pink_42-52/1'>42-52</scene>
If a similar change from the Wild-Type to 5 amino acids, in the region <scene name='61/611439/Cartoon_pink_42-52/1'>42-52</scene>

Revision as of 16:15, 30 November 2014

Does the amino acid sequence really determine the 3D structure of a peptide?')

2gb1

Drag the structure with the mouse to rotate

References

  1. Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
  2. Zhou X, Alber F, Folkers G, Gonnet GH, Chelvanayagam G. An analysis of the helix-to-strand transition between peptides with identical sequence. Proteins. 2000 Nov 1;41(2):248-56. PMID:10966577
Personal tools