This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.
Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.
Sandbox Reserved 996
From Proteopedia
(Difference between revisions)
| Line 3: | Line 3: | ||
<StructureSection load='1eci' size='340' side='right' caption='[[1eci]], [[NMR_Ensembles_of_Models | 20 NMR models]]' scene=''> | <StructureSection load='1eci' size='340' side='right' caption='[[1eci]], [[NMR_Ensembles_of_Models | 20 NMR models]]' scene=''> | ||
| - | Ectatomin (1eci) is the main component of venom of the ant [https://en.wikipedia.org/wiki/Ectatomma_tuberculatum Ectatomma tuberculatum]. When bitten by E. tuberculatum, Ectatomin inserts into the target's [https://en.wikipedia.org/wiki/Cell_membrane cell membranes] and forms a nonselective [https://en.wikipedia.org/wiki/Ion_channel cation channel]. | + | Ectatomin (1eci) is the main component of venom of the ant [https://en.wikipedia.org/wiki/Ectatomma_tuberculatum Ectatomma tuberculatum]. When bitten by E. tuberculatum, Ectatomin inserts into the target's [https://en.wikipedia.org/wiki/Cell_membrane cell membranes] and forms a nonselective [https://en.wikipedia.org/wiki/Ion_channel cation channel].<ref name="reftwo">PMID: 10336635</ref> |
| Line 17: | Line 17: | ||
| - | Sequence - α subunit - GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL | + | Sequence - α subunit - GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL<ref name="reftwo" /> |
| - | Sequence - β subunit - WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK | + | Sequence - β subunit - WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK<ref name="reftwo" /> |
Revision as of 22:56, 10 March 2015
Ectatomin (1eci)
| |||||||||||
References
- ↑ 1.0 1.1 1.2 1.3 Pluzhnikov K, Nosyreva E, Shevchenko L, Kokoz Y, Schmalz D, Hucho F, Grishin E. Analysis of ectatomin action on cell membranes. Eur J Biochem. 1999 Jun;262(2):501-6. PMID:10336635
- ↑ 2.0 2.1 2.2 2.3 Nolde DE, Sobol AG, Pluzhnikov KA, Grishin EV, Arseniev AS. Three-dimensional structure of ectatomin from Ectatomma tuberculatum ant venom. J Biomol NMR. 1995 Jan;5(1):1-13. PMID:7881269
- ↑ Arseniev AS, Pluzhnikov KA, Nolde DE, Sobol AG, Torgov MYu, Sukhanov SV, Grishin EV. Toxic principle of selva ant venom is a pore-forming protein transformer. FEBS Lett. 1994 Jun 27;347(2-3):112-6. PMID:8033986
- ↑ Touchard A, Labriere N, Roux O, Petitclerc F, Orivel J, Escoubas P, Koh JM, Nicholson GM, Dejean A. Venom toxicity and composition in three Pseudomyrmex ant species having different nesting modes. Toxicon. 2014 Sep;88:67-76. doi: 10.1016/j.toxicon.2014.05.022. Epub 2014 Jun 11. PMID:24929139 doi:http://dx.doi.org/10.1016/j.toxicon.2014.05.022
