We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.

Sandbox 323

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 30: Line 30:
The 3DS8 protein is part of the superfamily of alpha-beta hydrolases, so it most likely has the same function. Many structural and sequential similarities are conserved between 3DS8
The 3DS8 protein is part of the superfamily of alpha-beta hydrolases, so it most likely has the same function. Many structural and sequential similarities are conserved between 3DS8
and matched proteins, indicating that 3DS8 could very well be a hydrolase.
and matched proteins, indicating that 3DS8 could very well be a hydrolase.
 +
FASTA sequence of 3DS8:
FASTA sequence of 3DS8:
KDQIPIILIHGSGGNASSLDKMADQLMNEYRSSNEALTMTVNSEGKIKFEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKIAMEDLKSRYGFTQMDGVGHSNGGLALTYYAEDYAGDKTVPTLRKLVAIGSPFNDLD
KDQIPIILIHGSGGNASSLDKMADQLMNEYRSSNEALTMTVNSEGKIKFEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKIAMEDLKSRYGFTQMDGVGHSNGGLALTYYAEDYAGDKTVPTLRKLVAIGSPFNDLD
PNDNGMDLSFKKLPNSTPQMDYFIKNQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFMPGSAKAYIEDIQVGEDAVHQTLHETPKSIEKTYWFLEKFKTDETVIQLDYK
PNDNGMDLSFKKLPNSTPQMDYFIKNQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFMPGSAKAYIEDIQVGEDAVHQTLHETPKSIEKTYWFLEKFKTDETVIQLDYK
 +
InterPro Scan [5] searched for structure and taxonomy relations. The results have information about the domains and families of the protein. At the bottom, there are biological processes,
InterPro Scan [5] searched for structure and taxonomy relations. The results have information about the domains and families of the protein. At the bottom, there are biological processes,

Revision as of 00:10, 29 April 2024

Proposed Structure of 3DS8 Protein

3DS8 Structure

Drag the structure with the mouse to rotate

References

1. http://211.25.251.163/sprite/ 2. https://www.cgl.ucsf.edu/chimera/download.html 3. http://ekhidna2.biocenter.helsinki.fi/dali/ 4. https://blast.ncbi.nlm.nih.gov/Blast.cgi 5. https://www.ebi.ac.uk/interpro/

Personal tools