We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.

Sandbox 323

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 12: Line 12:
The function was not confirmed during wet lab experiments due to protein and reagent complications.
The function was not confirmed during wet lab experiments due to protein and reagent complications.
-
</StructureSection>
+
 
== Experimental ==
== Experimental ==
The beginning experiments were conducted on molecular docking sites to compare the structure of the 3DS8 active site with known proteins. Using the SPRITE database [1],
The beginning experiments were conducted on molecular docking sites to compare the structure of the 3DS8 active site with known proteins. Using the SPRITE database [1],
Line 36: Line 36:
FASTA sequence of 3DS8:
FASTA sequence of 3DS8:
-
KDQIPIILIHGSGGNASSLDKMADQLMNEYRSSNEALTMTVNSEGKIKFEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKIAMEDLKSRYGFTQMDGVGHSNGGLALTYYAEDYAGDKTVPTLRKLVAIGSPFNDLDP
+
KDQIPIILIHGSGGNASSLDKMADQLMNEYRSSNEALTMTVNSEGKIKFEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKIAMEDLKSRYGFTQMDGVGHSNGGLALTYYAEDYAGDKTVPTLRKLVAIGSPFNDLDPNDNGMDLSFKKLPNSTPQMDYFIKNQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFMPGSAKAYIEDIQVGEDAVHQTLHETPKSIEKTYWFLEKFKTDETVIQLDYK
-
NDNGMDLSFKKLPNSTPQMDYFIKNQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFMPGSAKAYIEDIQVGEDAVHQTLHETPKSIEKTYWFLEKFKTDETVIQLDYK
+
Line 51: Line 50:
The molecular weight of 3DS8 is proposed to be about 28 kDa.
The molecular weight of 3DS8 is proposed to be about 28 kDa.
-
 
+
</StructureSection>
==Discussion==
==Discussion==

Revision as of 00:18, 29 April 2024

Contents

Proposed Structure of 3DS8 Protein

3DS8 Structure

Drag the structure with the mouse to rotate

Discussion

Relevance

Conclusions

References

1. http://211.25.251.163/sprite/ 2. https://www.cgl.ucsf.edu/chimera/download.html 3. http://ekhidna2.biocenter.helsinki.fi/dali/ 4. https://blast.ncbi.nlm.nih.gov/Blast.cgi 5. https://www.ebi.ac.uk/interpro/

Personal tools