This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


2jr8

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Current revision (09:42, 9 May 2024) (edit) (undo)
 
(11 intermediate revisions not shown.)
Line 1: Line 1:
-
[[Image:2jr8.jpg|left|200px]]
 
-
{{Structure
+
==Solution structure of Manduca sexta moricin==
-
|PDB= 2jr8 |SIZE=350|CAPTION= <scene name='initialview01'>2jr8</scene>
+
<StructureSection load='2jr8' size='340' side='right'caption='[[2jr8]]' scene=''>
-
|SITE=
+
== Structural highlights ==
-
|LIGAND=
+
<table><tr><td colspan='2'>[[2jr8]] is a 1 chain structure with sequence from [https://en.wikipedia.org/wiki/Manduca_sexta Manduca sexta]. Full experimental information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2JR8 OCA]. For a <b>guided tour on the structure components</b> use [https://proteopedia.org/fgij/fg.htm?mol=2JR8 FirstGlance]. <br>
-
|ACTIVITY=
+
</td></tr><tr id='method'><td class="sblockLbl"><b>[[Empirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">Solution NMR</td></tr>
-
|GENE=
+
<tr id='resources'><td class="sblockLbl"><b>Resources:</b></td><td class="sblockDat"><span class='plainlinks'>[https://proteopedia.org/fgij/fg.htm?mol=2jr8 FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=2jr8 OCA], [https://pdbe.org/2jr8 PDBe], [https://www.rcsb.org/pdb/explore.do?structureId=2jr8 RCSB], [https://www.ebi.ac.uk/pdbsum/2jr8 PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2jr8 ProSAT]</span></td></tr>
-
|DOMAIN=<span class='plainlinks'>[http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=pfam06451 Moricin]</span>
+
</table>
-
|RELATEDENTRY=
+
== Function ==
-
|RESOURCES=<span class='plainlinks'>[http://oca.weizmann.ac.il/oca-docs/fgij/fg.htm?mol=2jr8 FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=2jr8 OCA], [http://www.ebi.ac.uk/pdbsum/2jr8 PDBsum], [http://www.rcsb.org/pdb/explore.do?structureId=2jr8 RCSB]</span>
+
[https://www.uniprot.org/uniprot/MOR_MANSE MOR_MANSE] Antimicrobial peptide. Active against a broad spectrum of Gram-positive and Gram-negative bacteria including methicillin-resistant S.aureus ATCC 43 300, S.aureus BAA-39, pathogenic strains of L.monocytogenes, K.pneumoniae, E.coli O157:H7, S.typhimurium and multidrug-resistant S.typhimurium DT104 with minimum inhibitory concentration (MIC) of 1.4 uM for all except for S.aureus BAA-39 (PubMed:18265434). Also active against Serratia marcescens (PubMed:14728663). Probably acts by disturbing membrane functions with its amphipathic alpha-helical structure (PubMed:18265434). May protect a developing embryo from bacterial infection (Probable).<ref>PMID:14728663</ref> <ref>PMID:18265434</ref>
-
}}
+
<div style="background-color:#fffaf0;">
-
 
+
== Publication Abstract from PubMed ==
-
'''Solution structure of Manduca sexta moricin'''
+
-
 
+
-
 
+
-
==Overview==
+
In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional (1)H--(1)H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. Copyright (c) 2008 European Peptide Society and John Wiley &amp; Sons, Ltd.
In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional (1)H--(1)H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. Copyright (c) 2008 European Peptide Society and John Wiley &amp; Sons, Ltd.
-
==About this Structure==
+
Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin.,Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H J Pept Sci. 2008 Feb 11;. PMID:18265434<ref>PMID:18265434</ref>
-
2JR8 is a [[Single protein]] structure of sequence from [http://en.wikipedia.org/wiki/ ]. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2JR8 OCA].
+
-
 
+
-
==Reference==
+
-
Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin., Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H, J Pept Sci. 2008 Feb 11;. PMID:[http://www.ncbi.nlm.nih.gov/pubmed/18265434 18265434]
+
-
[[Category: Single protein]]
+
-
[[Category: Dai, H.]]
+
-
[[Category: Gong, Y.]]
+
-
[[Category: Huang, R.]]
+
-
[[Category: Jiang, H.]]
+
-
[[Category: Prakash, O.]]
+
-
[[Category: Rayaprolu, S.]]
+
-
[[Category: antimicrobial peptide]]
+
-
[[Category: antimicrobial protein]]
+
-
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Mon Mar 31 04:01:03 2008''
+
From MEDLINE&reg;/PubMed&reg;, a database of the U.S. National Library of Medicine.<br>
 +
</div>
 +
<div class="pdbe-citations 2jr8" style="background-color:#fffaf0;"></div>
 +
== References ==
 +
<references/>
 +
__TOC__
 +
</StructureSection>
 +
[[Category: Large Structures]]
 +
[[Category: Manduca sexta]]
 +
[[Category: Dai H]]
 +
[[Category: Gong Y]]
 +
[[Category: Huang R]]
 +
[[Category: Jiang H]]
 +
[[Category: Prakash O]]
 +
[[Category: Rayaprolu S]]

Current revision

Solution structure of Manduca sexta moricin

PDB ID 2jr8

Drag the structure with the mouse to rotate

Proteopedia Page Contributors and Editors (what is this?)

OCA

Personal tools