This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.

Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.

2jr8

From Proteopedia

(Difference between revisions)

Jump to: navigation, search

Current revision

Solution structure of Manduca sexta moricin

Structural highlights

2jr8 is a 1 chain structure with sequence from Manduca sexta. Full experimental information is available from OCA. For a guided tour on the structure components use FirstGlance.
Method:	Solution NMR
Resources:	FirstGlance, OCA, PDBe, RCSB, PDBsum, ProSAT

Function

MOR_MANSE Antimicrobial peptide. Active against a broad spectrum of Gram-positive and Gram-negative bacteria including methicillin-resistant S.aureus ATCC 43 300, S.aureus BAA-39, pathogenic strains of L.monocytogenes, K.pneumoniae, E.coli O157:H7, S.typhimurium and multidrug-resistant S.typhimurium DT104 with minimum inhibitory concentration (MIC) of 1.4 uM for all except for S.aureus BAA-39 (PubMed:18265434). Also active against Serratia marcescens (PubMed:14728663). Probably acts by disturbing membrane functions with its amphipathic alpha-helical structure (PubMed:18265434). May protect a developing embryo from bacterial infection (Probable).^[1] ^[2]

Publication Abstract from PubMed

In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional (1)H--(1)H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. Copyright (c) 2008 European Peptide Society and John Wiley & Sons, Ltd.

Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin.,Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H J Pept Sci. 2008 Feb 11;. PMID:18265434^[3]

From MEDLINE®/PubMed®, a database of the U.S. National Library of Medicine.

References

↑ Gorman MJ, Kankanala P, Kanost MR. Bacterial challenge stimulates innate immune responses in extra-embryonic tissues of tobacco hornworm eggs. Insect Mol Biol. 2004 Feb;13(1):19-24. PMID:14728663 doi:10.1111/j.1365-2583.2004.00454.x
↑ Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H. Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin. J Pept Sci. 2008 Feb 11;. PMID:18265434 doi:10.1002/psc.1016
↑ Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H. Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin. J Pept Sci. 2008 Feb 11;. PMID:18265434 doi:10.1002/psc.1016

1 Structural highlights
2 Function
3 Publication Abstract from PubMed
4 References

Proteopedia Page Contributors and Editors (what is this?)

OCA

Retrieved from "http://52.214.119.220/wiki/index.php/2jr8"

@@ Line 1: / Line 1: @@
 ==Solution structure of Manduca sexta moricin==
-<StructureSection load='2jr8' size='340' side='right'caption='[[2jr8]], [[NMR_Ensembles_of_Models | 20 NMR models]]' scene=''>
+<StructureSection load='2jr8' size='340' side='right'caption='[[2jr8]]' scene=''>
 == Structural highlights ==
-<table><tr><td colspan='2'>[[2jr8]] is a 1 chain structure. Full experimental information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2JR8 OCA]. For a <b>guided tour on the structure components</b> use [https://proteopedia.org/fgij/fg.htm?mol=2JR8 FirstGlance]. <br>
+<table><tr><td colspan='2'>[[2jr8]] is a 1 chain structure with sequence from [https://en.wikipedia.org/wiki/Manduca_sexta Manduca sexta]. Full experimental information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2JR8 OCA]. For a <b>guided tour on the structure components</b> use [https://proteopedia.org/fgij/fg.htm?mol=2JR8 FirstGlance]. <br>
-</td></tr><tr id='resources'><td class="sblockLbl"><b>Resources:</b></td><td class="sblockDat"><span class='plainlinks'>[https://proteopedia.org/fgij/fg.htm?mol=2jr8 FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=2jr8 OCA], [https://pdbe.org/2jr8 PDBe], [https://www.rcsb.org/pdb/explore.do?structureId=2jr8 RCSB], [https://www.ebi.ac.uk/pdbsum/2jr8 PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2jr8 ProSAT]</span></td></tr>
+</td></tr><tr id='method'><td class="sblockLbl"><b>[[Empirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">Solution NMR</td></tr>
+<tr id='resources'><td class="sblockLbl"><b>Resources:</b></td><td class="sblockDat"><span class='plainlinks'>[https://proteopedia.org/fgij/fg.htm?mol=2jr8 FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=2jr8 OCA], [https://pdbe.org/2jr8 PDBe], [https://www.rcsb.org/pdb/explore.do?structureId=2jr8 RCSB], [https://www.ebi.ac.uk/pdbsum/2jr8 PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2jr8 ProSAT]</span></td></tr>
 </table>
+== Function ==
+[https://www.uniprot.org/uniprot/MOR_MANSE MOR_MANSE] Antimicrobial peptide. Active against a broad spectrum of Gram-positive and Gram-negative bacteria including methicillin-resistant S.aureus ATCC 43 300, S.aureus BAA-39, pathogenic strains of L.monocytogenes, K.pneumoniae, E.coli O157:H7, S.typhimurium and multidrug-resistant S.typhimurium DT104 with minimum inhibitory concentration (MIC) of 1.4 uM for all except for S.aureus BAA-39 (PubMed:18265434). Also active against Serratia marcescens (PubMed:14728663). Probably acts by disturbing membrane functions with its amphipathic alpha-helical structure (PubMed:18265434). May protect a developing embryo from bacterial infection (Probable).<ref>PMID:14728663</ref> <ref>PMID:18265434</ref>
 <div style="background-color:#fffaf0;">
 == Publication Abstract from PubMed ==
@@ Line 20: / Line 23: @@
 </StructureSection>
 [[Category: Large Structures]]
-[[Category: Dai, H]]
+[[Category: Manduca sexta]]
-[[Category: Gong, Y]]
+[[Category: Dai H]]
-[[Category: Huang, R]]
+[[Category: Gong Y]]
-[[Category: Jiang, H]]
+[[Category: Huang R]]
-[[Category: Prakash, O]]
+[[Category: Jiang H]]
-[[Category: Rayaprolu, S]]
+[[Category: Prakash O]]
-[[Category: Antimicrobial peptide]]
+[[Category: Rayaprolu S]]
-[[Category: Antimicrobial protein]]

2jr8

From Proteopedia

Current revision

Solution structure of Manduca sexta moricin

Structural highlights

Function

Publication Abstract from PubMed

References

Contents

Proteopedia Page Contributors and Editors (what is this?)

Views

Personal tools

Navigation

Search

Toolbox