This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


2aks

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Current revision (14:42, 17 November 2021) (edit) (undo)
 
(8 intermediate revisions not shown.)
Line 1: Line 1:
{{Theoretical_model}}
{{Theoretical_model}}
-
{{Seed}}
 
-
[[Image:2aks.png|left|200px]]
 
-
<!--
+
==HOMOLOGY MODEL OF THE CYCLOTIDE VODO N==
-
The line below this paragraph, containing "STRUCTURE_2aks", creates the "Structure Box" on the page.
+
<StructureSection load='2aks' size='340' side='right'caption='[[2aks]]' scene=''>
-
You may change the PDB parameter (which sets the PDB file loaded into the applet)
+
== Structural highlights ==
-
or the SCENE parameter (which sets the initial scene displayed when the page is loaded),
+
<table><tr><td colspan='2'>For a <b>guided tour on the structure components</b> use [https://proteopedia.org/fgij/fg.htm?mol=2AKS FirstGlance]. <br>
-
or leave the SCENE parameter empty for the default display.
+
</td></tr><tr id='resources'><td class="sblockLbl"><b>Resources:</b></td><td class="sblockDat"><span class='plainlinks'>[https://proteopedia.org/fgij/fg.htm?mol=2aks FirstGlance], [https://www.ebi.ac.uk/pdbsum/2aks PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2aks ProSAT]</span></td></tr>
-
-->
+
</table>
-
{{STRUCTURE_2aks| PDB=2aks | SCENE= }}
+
<div style="background-color:#fffaf0;">
 +
== Publication Abstract from PubMed ==
 +
Two polypeptides named vodo M and vodo N, both of 29 amino acids, have been isolated from Viola odorata L. (Violaceae) using ion exchange chromatography and reversed phase HPLC. The sequences were determined by automated Edman degradation, quantitative amino acid analysis, and mass spectrometry (MS). Using MS, it was established that vodo M (cyclo-SWPVCTRNGAPICGESCFTGKCYTVQCSC) and vodo N (cyclo-SWPVCYRNGLPVCGETCTLGKCYTAGCSC) form a head-to-tail cyclic backbone and that six cysteine residues are involved in three disulphide bonds. Their origin, sequences, and cyclic nature suggest that these peptides belong to the family of cyclic plant peptides, called cyclotides. The three-dimensional structures of vodo M and vodo N were modelled by homology, using the experimentally determined structure of the cyclotide kalata B1 as the template. The images of vodo M and vodo N show amphipathic structures with considerable surface hydrophobicity for a protein modelled in a polar environment.
-
===HOMOLOGY MODEL OF THE CYCLOTIDE VODO N===
+
Primary and 3-D modelled structures of two cyclotides from Viola odorata.,Svangard E, Goransson U, Smith D, Verma C, Backlund A, Bohlin L, Claeson P Phytochemistry. 2003 Sep;64(1):135-42. PMID:12946412<ref>PMID:12946412</ref>
-
 
+
From MEDLINE&reg;/PubMed&reg;, a database of the U.S. National Library of Medicine.<br>
-
<!--
+
</div>
-
The line below this paragraph, {{ABSTRACT_PUBMED_12946412}}, adds the Publication Abstract to the page
+
<div class="pdbe-citations 2aks" style="background-color:#fffaf0;"></div>
-
(as it appears on PubMed at http://www.pubmed.gov), where 12946412 is the PubMed ID number.
+
== References ==
-
-->
+
<references/>
-
{{ABSTRACT_PUBMED_12946412}}
+
__TOC__
-
 
+
</StructureSection>
-
==About this Structure==
+
[[Category: Theoretical Model]]
-
Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2AKS OCA].
+
[[Category: Large Structures]]
-
 
+
-
==Reference==
+
-
<ref group="xtra">PMID:12946412</ref><references group="xtra"/>
+
[[Category: Backlund, A]]
[[Category: Backlund, A]]
[[Category: Bohlin, L]]
[[Category: Bohlin, L]]
Line 32: Line 29:
[[Category: Svangard, E]]
[[Category: Svangard, E]]
[[Category: Verma, C]]
[[Category: Verma, C]]
- 
-
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Thu Apr 8 09:01:19 2010''
 

Current revision

Theoretical Model: The protein structure described on this page was determined theoretically, and hence should be interpreted with caution.

HOMOLOGY MODEL OF THE CYCLOTIDE VODO N

PDB ID 2aks

Drag the structure with the mouse to rotate

Proteopedia Page Contributors and Editors (what is this?)

OCA

Personal tools