This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.
Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.
2aks
From Proteopedia
(Difference between revisions)
m (Protected "2aks" [edit=sysop:move=sysop]) |
|||
| (6 intermediate revisions not shown.) | |||
| Line 1: | Line 1: | ||
{{Theoretical_model}} | {{Theoretical_model}} | ||
| - | [[ | + | ==HOMOLOGY MODEL OF THE CYCLOTIDE VODO N== |
| + | <StructureSection load='2aks' size='340' side='right'caption='[[2aks]]' scene=''> | ||
| + | == Structural highlights == | ||
| + | <table><tr><td colspan='2'>For a <b>guided tour on the structure components</b> use [https://proteopedia.org/fgij/fg.htm?mol=2AKS FirstGlance]. <br> | ||
| + | </td></tr><tr id='resources'><td class="sblockLbl"><b>Resources:</b></td><td class="sblockDat"><span class='plainlinks'>[https://proteopedia.org/fgij/fg.htm?mol=2aks FirstGlance], [https://www.ebi.ac.uk/pdbsum/2aks PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2aks ProSAT]</span></td></tr> | ||
| + | </table> | ||
| + | <div style="background-color:#fffaf0;"> | ||
| + | == Publication Abstract from PubMed == | ||
| + | Two polypeptides named vodo M and vodo N, both of 29 amino acids, have been isolated from Viola odorata L. (Violaceae) using ion exchange chromatography and reversed phase HPLC. The sequences were determined by automated Edman degradation, quantitative amino acid analysis, and mass spectrometry (MS). Using MS, it was established that vodo M (cyclo-SWPVCTRNGAPICGESCFTGKCYTVQCSC) and vodo N (cyclo-SWPVCYRNGLPVCGETCTLGKCYTAGCSC) form a head-to-tail cyclic backbone and that six cysteine residues are involved in three disulphide bonds. Their origin, sequences, and cyclic nature suggest that these peptides belong to the family of cyclic plant peptides, called cyclotides. The three-dimensional structures of vodo M and vodo N were modelled by homology, using the experimentally determined structure of the cyclotide kalata B1 as the template. The images of vodo M and vodo N show amphipathic structures with considerable surface hydrophobicity for a protein modelled in a polar environment. | ||
| - | + | Primary and 3-D modelled structures of two cyclotides from Viola odorata.,Svangard E, Goransson U, Smith D, Verma C, Backlund A, Bohlin L, Claeson P Phytochemistry. 2003 Sep;64(1):135-42. PMID:12946412<ref>PMID:12946412</ref> | |
| - | + | From MEDLINE®/PubMed®, a database of the U.S. National Library of Medicine.<br> | |
| - | + | </div> | |
| - | + | <div class="pdbe-citations 2aks" style="background-color:#fffaf0;"></div> | |
| - | + | == References == | |
| - | + | <references/> | |
| - | < | + | __TOC__ |
| + | </StructureSection> | ||
| + | [[Category: Theoretical Model]] | ||
| + | [[Category: Large Structures]] | ||
[[Category: Backlund, A]] | [[Category: Backlund, A]] | ||
[[Category: Bohlin, L]] | [[Category: Bohlin, L]] | ||
Current revision
| Theoretical Model: The protein structure described on this page was determined theoretically, and hence should be interpreted with caution. |
HOMOLOGY MODEL OF THE CYCLOTIDE VODO N
| |||||||||||
