This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


Chameleon peptide

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Current revision (07:08, 1 February 2016) (edit) (undo)
 
(14 intermediate revisions not shown.)
Line 1: Line 1:
-
==Does the amino acid sequence ''really'' determine the 3D structure of a peptide?')==
+
==Does the amino acid sequence ''really'' determine the 3D structure of a peptide?==
-
<StructureSection load='2gb1' size='350' side='right' caption='2gb1' scene='61/611445/Rainbow_cartoon/1'>
+
<StructureSection load='2gb1' size='350' side='right' caption='Protein G immunoglobulin binding domain (PDB code [[2gb1]])' scene='61/611445/Rainbow_cartoon/1'>
[[Image:Chameleon.jpg|left|170px|thumb|Chamelion]]
[[Image:Chameleon.jpg|left|170px|thumb|Chamelion]]
==General question==
==General question==
Line 9: Line 9:
== Seeing is believing ==
== Seeing is believing ==
-
To simplify the figure, the entire IgG-Binding domain<ref>PMID:1871600 </ref> is colored <scene name='61/611445/Cartoon_beige/1'>beige</scene>. Now displaying, in pink, the amino acids in the region <scene name='61/611445/Cartoon_pink_23-33/1'>23-33</scene>, are change to the ''Chameleon'' sequence, i.e. '''AWTVEKAFKTF''' (only 5 amino acids are mutated), specifically from/to:<br />
+
To simplify the figure, the entire IgG-Binding domain<ref>PMID:1871600 </ref> is colored <scene name='61/611445/Cartoon_beige/1'>beige</scene>. Now, if the amino acids residues, <<scene name='61/611445/Cartoon_blanche/2'>23-33</scene>>, are changed to the ''Chameleon'' sequence i.e. <span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>, virtually no change in structure is seen.
 +
Specifically the WT sequence in yellow (residues 23-33) is changed to Chameleon sequence shown in pink, , n.b. only 5 AA's have been changed in this region<br />
-
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK<br />
+
<font face=Courier>
-
TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK
+
WT: &emsp;&emsp;&emsp;&emsp; TTYKLILNGKTLKGETTTEAVD<span style="color:#000000; background:#FFFF00">AATAEKVFKQY</span style>ANDNGVDGEWTYDDATKTFTVTEK<br />
 +
Mutated: TTYKLILNGKTLKGETTTEAVD<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>ANDNGVDGEWTYDDATKTFTVTEK</font face>
-
If a similar change from the Wild-Type to where 5 amino acids, in the region <scene name='61/611445/Cartoon_pink_42-52/1'>42-52</scene> are changed to the ''Chameleon'' sequence, specifically from/to:<br />
+
If a similar change in the WT sequences is made to the Chameleon sequence for residues <scene name='61/611445/Cartoon_pink_42-52/1'>42-52</scene> again virtually no change in the 3D structure of this protein is seen.<br />
-
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK<br />
+
<font face=Courier>
-
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG'''AWTVEKAFKTF'''TVTEK
+
WT: &emsp;&emsp;&emsp;&emsp; TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#000000; background:#FFFF00">EWTYDDATKTF</span style>TVTEK<br />
 +
Mutated: TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>TVTEK</font face>
-
== 3D structure of sequence adopts to environment ==
+
== 3D structure of a sequence adopts to its environment ==
The 3D structure of the ''Chameleon'' sequence, '''AWTVEKAFKTF''', appears to adopt to its environment.
The 3D structure of the ''Chameleon'' sequence, '''AWTVEKAFKTF''', appears to adopt to its environment.
</StructureSection>
</StructureSection>
== References ==
== References ==
<references/>
<references/>

Current revision

Does the amino acid sequence really determine the 3D structure of a peptide?

Protein G immunoglobulin binding domain (PDB code 2gb1)

Drag the structure with the mouse to rotate

References

  1. Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
  2. Zhou X, Alber F, Folkers G, Gonnet GH, Chelvanayagam G. An analysis of the helix-to-strand transition between peptides with identical sequence. Proteins. 2000 Nov 1;41(2):248-56. PMID:10966577
  3. Gronenborn AM, Filpula DR, Essig NZ, Achari A, Whitlow M, Wingfield PT, Clore GM. A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein G. Science. 1991 Aug 9;253(5020):657-61. PMID:1871600

Proteopedia Page Contributors and Editors (what is this?)

Joel L. Sussman, Michal Harel

Personal tools