Chameleon peptide

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Current revision (07:08, 1 February 2016) (edit) (undo)
 
(3 intermediate revisions not shown.)
Line 1: Line 1:
-
==Does the amino acid sequence ''really'' determine the 3D structure of a peptide?')==
+
==Does the amino acid sequence ''really'' determine the 3D structure of a peptide?==
-
<StructureSection load='2gb1' size='350' side='right' caption='2gb1' scene='61/611445/Rainbow_cartoon/1'>
+
<StructureSection load='2gb1' size='350' side='right' caption='Protein G immunoglobulin binding domain (PDB code [[2gb1]])' scene='61/611445/Rainbow_cartoon/1'>
[[Image:Chameleon.jpg|left|170px|thumb|Chamelion]]
[[Image:Chameleon.jpg|left|170px|thumb|Chamelion]]
==General question==
==General question==
Line 9: Line 9:
== Seeing is believing ==
== Seeing is believing ==
-
To simplify the figure, the entire IgG-Binding domain<ref>PMID:1871600 </ref> is colored <scene name='61/611445/Cartoon_beige/1'>beige</scene>. Now, if the amino acids residues, <scene name='61/611445/Cartoon_pink_23-33/1'>23-33</scene>, are changed to the ''Chameleon'' sequence i.e. <span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>, virtually no change in structure is seen.
+
To simplify the figure, the entire IgG-Binding domain<ref>PMID:1871600 </ref> is colored <scene name='61/611445/Cartoon_beige/1'>beige</scene>. Now, if the amino acids residues, <<scene name='61/611445/Cartoon_blanche/2'>23-33</scene>>, are changed to the ''Chameleon'' sequence i.e. <span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>, virtually no change in structure is seen.
Specifically the WT sequence in yellow (residues 23-33) is changed to Chameleon sequence shown in pink, , n.b. only 5 AA's have been changed in this region<br />
Specifically the WT sequence in yellow (residues 23-33) is changed to Chameleon sequence shown in pink, , n.b. only 5 AA's have been changed in this region<br />
Line 21: Line 21:
Mutated: TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>TVTEK</font face>
Mutated: TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>TVTEK</font face>
-
== 3D structure of sequence adopts to environment ==
+
== 3D structure of a sequence adopts to its environment ==
The 3D structure of the ''Chameleon'' sequence, '''AWTVEKAFKTF''', appears to adopt to its environment.
The 3D structure of the ''Chameleon'' sequence, '''AWTVEKAFKTF''', appears to adopt to its environment.
</StructureSection>
</StructureSection>
== References ==
== References ==
<references/>
<references/>

Current revision

Does the amino acid sequence really determine the 3D structure of a peptide?

Protein G immunoglobulin binding domain (PDB code 2gb1)

Drag the structure with the mouse to rotate

References

  1. Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
  2. Zhou X, Alber F, Folkers G, Gonnet GH, Chelvanayagam G. An analysis of the helix-to-strand transition between peptides with identical sequence. Proteins. 2000 Nov 1;41(2):248-56. PMID:10966577
  3. Gronenborn AM, Filpula DR, Essig NZ, Achari A, Whitlow M, Wingfield PT, Clore GM. A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein G. Science. 1991 Aug 9;253(5020):657-61. PMID:1871600

Proteopedia Page Contributors and Editors (what is this?)

Joel L. Sussman, Michal Harel

Personal tools