User:Nikhil Malvankar/Geobacter pilus

From Proteopedia

< User:Nikhil Malvankar(Difference between revisions)
Jump to: navigation, search
Current revision (22:23, 8 August 2021) (edit) (undo)
 
(3 intermediate revisions not shown.)
Line 11: Line 11:
[[Image:Blank-white-30x460px.png]]<br>
[[Image:Blank-white-30x460px.png]]<br>
<span style="font-size:160%"><b>Structural basis for metallic-like conductivity in microbial nanowires.</b></span><br><br>
<span style="font-size:160%"><b>Structural basis for metallic-like conductivity in microbial nanowires.</b></span><br><br>
-
<span style="font-size:120%">Nikhil S. '''[[Malvankar]]''', Madeline '''Vargas''', Kelly '''Nevin''', Pier-Luc '''Tremblay''', Kenneth '''Evans-Lutterodt''', Dmytro '''Nykypanchuk''', Eric '''[[User:Eric Martz|Martz]]''', Mark T. '''Tuominen''', Derek R. '''[http://www.micro.umass.edu/faculty-and-research/derek-lovley Lovley]'''. [http://mbio.asm.org/content/6/2/e00084-15.abstract mBio 6(2):e00084-15]. ([http://dx.doi.org/10.1128/mBio.00084-15 doi:10.1128/mBio.00084-15])
+
<span style="font-size:120%">Nikhil S. '''[[Malvankar]]''', Madeline '''Vargas''', Kelly '''Nevin''', Pier-Luc '''Tremblay''', Kenneth '''Evans-Lutterodt''', Dmytro '''Nykypanchuk''', Eric '''[[User:Eric Martz|Martz]]''', Mark T. '''Tuominen''', Derek R. '''[http://www.micro.umass.edu/faculty-and-research/derek-lovley Lovley]'''. [http://mbio.asm.org/content/6/2/e00084-15.abstract mBio 6(2):e00084-15] (2015). ([http://dx.doi.org/10.1128/mBio.00084-15 doi:10.1128/mBio.00084-15])
</span>
</span>
 +
<table class="wikitable" style="background-color:#ffffa0;"><tr><td>
 +
CAVEAT: The homology model described here was published in 2015. In 2019, [[cryo-EM]] structures of highly conductive ''Geobacter'' nanowires were found to be composed of the cytochrome OmcS<ref name="wang-gu">PMID:30951668</ref><ref name="filman">PMID:31925024</ref>. This called into question whether highly conductive pilus nanowires composed of the protein pilA exist.
 +
</td></tr></table>
==Molecular Tour==
==Molecular Tour==
<StructureSection size='[250,500]' side='right' caption='Geobacter pilus homology model' scene='59/595215/2_gs_pilin_models/2'>
<StructureSection size='[250,500]' side='right' caption='Geobacter pilus homology model' scene='59/595215/2_gs_pilin_models/2'>
===Geobacter Pilin Monomers===
===Geobacter Pilin Monomers===
-
Two pilin monomer models (<scene name='59/595215/2_gs_pilin_models/2'>restore initial scene</scene>) were utilized. First, we made a homology model templated on the X-ray crystallographic structure of the pilin of ''Pseudomonas aeruginosa''<ref>A ''Geobacter sulfurreducens'' pilin (pilA) homology model was constructed by Swiss-Model, templated on the X-ray crystallographic structure of ''Pseudomonas aeruginosa'' pilin ([[1oqw]], chain A). This model represents residues 1-60 of the mature pilin protein (length 61 amino acids: residues 30-90 of [http://www.uniprot.org/uniprot/D7AIT1 D7AIT1]), sequence {{Yelspan|F}}TLIELLIVVAIIGILAAIAIPQ{{Yelspan|F}}SA{{Yelspan|Y}}RVKA{{Yelspan|Y}}NSAASSDLRNLKTALESA{{Yelspan|F}}ADDQT{{Yelspan|Y}}PPES. This monomer includes six {{Yelspan|aromatic residues}}, F1, F24, Y27, Y32, F51 and Y57.</ref>. This model is colored in amino-to-carboxy rainbow coloring:
+
Two pilin monomer models (<scene name='59/595215/2_gs_pilin_models/2'>restore initial scene</scene>) were utilized. First, we made a homology model templated on the X-ray crystallographic structure of the pilin of ''Pseudomonas aeruginosa''<ref>A ''Geobacter sulfurreducens'' pilin (pilA) homology model was constructed by Swiss-Model, templated on the X-ray crystallographic structure of ''Pseudomonas aeruginosa'' pilin ([[1oqw]], chain A). This model represents residues 1-60 of the mature pilin protein (length 61 amino acids: residues 30-90 of [http://www.uniprot.org/uniprot/Q74D23 Q74D23]), sequence {{Yelspan|F}}TLIELLIVVAIIGILAAIAIPQ{{Yelspan|F}}SA{{Yelspan|Y}}RVKA{{Yelspan|Y}}NSAASSDLRNLKTALESA{{Yelspan|F}}ADDQT{{Yelspan|Y}}PPES. This monomer includes six {{Yelspan|aromatic residues}}, F1, F24, Y27, Y32, F51 and Y57.</ref>. This model is colored in amino-to-carboxy rainbow coloring:
{{Template:ColorKey_Amino2CarboxyRainbow}}
{{Template:ColorKey_Amino2CarboxyRainbow}}
Second, we utilized model 5 of the NMR ensemble of ''Geobacter sulfurreducens'' pilin<ref>We employed the NMR structure of ''Geobacter sulfurreducens'' pilin, [[2m7g]]. We employed model 5 of this 18-conformer ensemble because model 5 had the best clash score and [[MolProbity]] score.</ref>.
Second, we utilized model 5 of the NMR ensemble of ''Geobacter sulfurreducens'' pilin<ref>We employed the NMR structure of ''Geobacter sulfurreducens'' pilin, [[2m7g]]. We employed model 5 of this 18-conformer ensemble because model 5 had the best clash score and [[MolProbity]] score.</ref>.
Line 34: Line 37:
</StructureSection>
</StructureSection>
-
<br><hr><br>
+
<br>
 +
{{Theoretical_model}}
 +
<hr><br>
==Download==
==Download==
===Pilus Model===
===Pilus Model===

Current revision

Interactive 3D Complement in Proteopedia

About this image

Image:Blank-white-30x460px.png
Structural basis for metallic-like conductivity in microbial nanowires.

Nikhil S. Malvankar, Madeline Vargas, Kelly Nevin, Pier-Luc Tremblay, Kenneth Evans-Lutterodt, Dmytro Nykypanchuk, Eric Martz, Mark T. Tuominen, Derek R. Lovley. mBio 6(2):e00084-15 (2015). (doi:10.1128/mBio.00084-15)

CAVEAT: The homology model described here was published in 2015. In 2019, cryo-EM structures of highly conductive Geobacter nanowires were found to be composed of the cytochrome OmcS[1][2]. This called into question whether highly conductive pilus nanowires composed of the protein pilA exist.

Contents

Molecular Tour

Geobacter pilus homology model

Drag the structure with the mouse to rotate


Theoretical Model: The protein structure described on this page was determined theoretically, and hence should be interpreted with caution.


Download

Pilus Model

Animations for Powerpoint

Click images to see them full size, or to download them.

See Also

Notes & References

  1. Wang F, Gu Y, O'Brien JP, Yi SM, Yalcin SE, Srikanth V, Shen C, Vu D, Ing NL, Hochbaum AI, Egelman EH, Malvankar NS. Structure of Microbial Nanowires Reveals Stacked Hemes that Transport Electrons over Micrometers. Cell. 2019 Apr 4;177(2):361-369.e10. doi: 10.1016/j.cell.2019.03.029. PMID:30951668 doi:http://dx.doi.org/10.1016/j.cell.2019.03.029
  2. Filman DJ, Marino SF, Ward JE, Yang L, Mester Z, Bullitt E, Lovley DR, Strauss M. Cryo-EM reveals the structural basis of long-range electron transport in a cytochrome-based bacterial nanowire. Commun Biol. 2019 Jun 19;2(1):219. doi: 10.1038/s42003-019-0448-9. PMID:31925024 doi:http://dx.doi.org/10.1038/s42003-019-0448-9
  3. A Geobacter sulfurreducens pilin (pilA) homology model was constructed by Swiss-Model, templated on the X-ray crystallographic structure of Pseudomonas aeruginosa pilin (1oqw, chain A). This model represents residues 1-60 of the mature pilin protein (length 61 amino acids: residues 30-90 of Q74D23), sequence FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES. This monomer includes six aromatic residues, F1, F24, Y27, Y32, F51 and Y57.
  4. We employed the NMR structure of Geobacter sulfurreducens pilin, 2m7g. We employed model 5 of this 18-conformer ensemble because model 5 had the best clash score and MolProbity score.
  5. The Geobacter sequence is identical to the template Pseudomonas sequence in 22 of the first 23 residues. Residues 24-50 have 26% sequence identity.
  6. Craig L, Pique ME, Tainer JA. Type IV pilus structure and bacterial pathogenicity. Nat Rev Microbiol. 2004 May;2(5):363-78. PMID:15100690 doi:http://dx.doi.org/10.1038/nrmicro885

Proteopedia Page Contributors and Editors (what is this?)

Eric Martz

Personal tools