User:Nikhil Malvankar/Geobacter pilus
From Proteopedia
< User:Nikhil Malvankar(Difference between revisions)
| (One intermediate revision not shown.) | |||
| Line 13: | Line 13: | ||
<span style="font-size:120%">Nikhil S. '''[[Malvankar]]''', Madeline '''Vargas''', Kelly '''Nevin''', Pier-Luc '''Tremblay''', Kenneth '''Evans-Lutterodt''', Dmytro '''Nykypanchuk''', Eric '''[[User:Eric Martz|Martz]]''', Mark T. '''Tuominen''', Derek R. '''[http://www.micro.umass.edu/faculty-and-research/derek-lovley Lovley]'''. [http://mbio.asm.org/content/6/2/e00084-15.abstract mBio 6(2):e00084-15] (2015). ([http://dx.doi.org/10.1128/mBio.00084-15 doi:10.1128/mBio.00084-15]) | <span style="font-size:120%">Nikhil S. '''[[Malvankar]]''', Madeline '''Vargas''', Kelly '''Nevin''', Pier-Luc '''Tremblay''', Kenneth '''Evans-Lutterodt''', Dmytro '''Nykypanchuk''', Eric '''[[User:Eric Martz|Martz]]''', Mark T. '''Tuominen''', Derek R. '''[http://www.micro.umass.edu/faculty-and-research/derek-lovley Lovley]'''. [http://mbio.asm.org/content/6/2/e00084-15.abstract mBio 6(2):e00084-15] (2015). ([http://dx.doi.org/10.1128/mBio.00084-15 doi:10.1128/mBio.00084-15]) | ||
</span> | </span> | ||
| + | <table class="wikitable" style="background-color:#ffffa0;"><tr><td> | ||
| + | CAVEAT: The homology model described here was published in 2015. In 2019, [[cryo-EM]] structures of highly conductive ''Geobacter'' nanowires were found to be composed of the cytochrome OmcS<ref name="wang-gu">PMID:30951668</ref><ref name="filman">PMID:31925024</ref>. This called into question whether highly conductive pilus nanowires composed of the protein pilA exist. | ||
| + | </td></tr></table> | ||
==Molecular Tour== | ==Molecular Tour== | ||
<StructureSection size='[250,500]' side='right' caption='Geobacter pilus homology model' scene='59/595215/2_gs_pilin_models/2'> | <StructureSection size='[250,500]' side='right' caption='Geobacter pilus homology model' scene='59/595215/2_gs_pilin_models/2'> | ||
===Geobacter Pilin Monomers=== | ===Geobacter Pilin Monomers=== | ||
| - | Two pilin monomer models (<scene name='59/595215/2_gs_pilin_models/2'>restore initial scene</scene>) were utilized. First, we made a homology model templated on the X-ray crystallographic structure of the pilin of ''Pseudomonas aeruginosa''<ref>A ''Geobacter sulfurreducens'' pilin (pilA) homology model was constructed by Swiss-Model, templated on the X-ray crystallographic structure of ''Pseudomonas aeruginosa'' pilin ([[1oqw]], chain A). This model represents residues 1-60 of the mature pilin protein (length 61 amino acids: residues 30-90 of [http://www.uniprot.org/uniprot/ | + | Two pilin monomer models (<scene name='59/595215/2_gs_pilin_models/2'>restore initial scene</scene>) were utilized. First, we made a homology model templated on the X-ray crystallographic structure of the pilin of ''Pseudomonas aeruginosa''<ref>A ''Geobacter sulfurreducens'' pilin (pilA) homology model was constructed by Swiss-Model, templated on the X-ray crystallographic structure of ''Pseudomonas aeruginosa'' pilin ([[1oqw]], chain A). This model represents residues 1-60 of the mature pilin protein (length 61 amino acids: residues 30-90 of [http://www.uniprot.org/uniprot/Q74D23 Q74D23]), sequence {{Yelspan|F}}TLIELLIVVAIIGILAAIAIPQ{{Yelspan|F}}SA{{Yelspan|Y}}RVKA{{Yelspan|Y}}NSAASSDLRNLKTALESA{{Yelspan|F}}ADDQT{{Yelspan|Y}}PPES. This monomer includes six {{Yelspan|aromatic residues}}, F1, F24, Y27, Y32, F51 and Y57.</ref>. This model is colored in amino-to-carboxy rainbow coloring: |
{{Template:ColorKey_Amino2CarboxyRainbow}} | {{Template:ColorKey_Amino2CarboxyRainbow}} | ||
Second, we utilized model 5 of the NMR ensemble of ''Geobacter sulfurreducens'' pilin<ref>We employed the NMR structure of ''Geobacter sulfurreducens'' pilin, [[2m7g]]. We employed model 5 of this 18-conformer ensemble because model 5 had the best clash score and [[MolProbity]] score.</ref>. | Second, we utilized model 5 of the NMR ensemble of ''Geobacter sulfurreducens'' pilin<ref>We employed the NMR structure of ''Geobacter sulfurreducens'' pilin, [[2m7g]]. We employed model 5 of this 18-conformer ensemble because model 5 had the best clash score and [[MolProbity]] score.</ref>. | ||
Current revision
Interactive 3D Complement in Proteopedia
![]()
Structural basis for metallic-like conductivity in microbial nanowires.
Nikhil S. Malvankar, Madeline Vargas, Kelly Nevin, Pier-Luc Tremblay, Kenneth Evans-Lutterodt, Dmytro Nykypanchuk, Eric Martz, Mark T. Tuominen, Derek R. Lovley. mBio 6(2):e00084-15 (2015). (doi:10.1128/mBio.00084-15)
|
CAVEAT: The homology model described here was published in 2015. In 2019, cryo-EM structures of highly conductive Geobacter nanowires were found to be composed of the cytochrome OmcS[1][2]. This called into question whether highly conductive pilus nanowires composed of the protein pilA exist. |
Contents |
Molecular Tour
| |||||||||||
| Theoretical Model: The protein structure described on this page was determined theoretically, and hence should be interpreted with caution. |
Download
Pilus Model
- Click to download Geobacter sulfurreducens pilus homology model templated on Pseudomonas pilus model.
Animations for Powerpoint
Click images to see them full size, or to download them.
-
Pilus Assembly Simulation
- Pilus Model, Rocking
- Aromatic rings (yellow) in pilus model
See Also
Notes & References
- ↑ Wang F, Gu Y, O'Brien JP, Yi SM, Yalcin SE, Srikanth V, Shen C, Vu D, Ing NL, Hochbaum AI, Egelman EH, Malvankar NS. Structure of Microbial Nanowires Reveals Stacked Hemes that Transport Electrons over Micrometers. Cell. 2019 Apr 4;177(2):361-369.e10. doi: 10.1016/j.cell.2019.03.029. PMID:30951668 doi:http://dx.doi.org/10.1016/j.cell.2019.03.029
- ↑ Filman DJ, Marino SF, Ward JE, Yang L, Mester Z, Bullitt E, Lovley DR, Strauss M. Cryo-EM reveals the structural basis of long-range electron transport in a cytochrome-based bacterial nanowire. Commun Biol. 2019 Jun 19;2(1):219. doi: 10.1038/s42003-019-0448-9. PMID:31925024 doi:http://dx.doi.org/10.1038/s42003-019-0448-9
- ↑ A Geobacter sulfurreducens pilin (pilA) homology model was constructed by Swiss-Model, templated on the X-ray crystallographic structure of Pseudomonas aeruginosa pilin (1oqw, chain A). This model represents residues 1-60 of the mature pilin protein (length 61 amino acids: residues 30-90 of Q74D23), sequence FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES. This monomer includes six aromatic residues, F1, F24, Y27, Y32, F51 and Y57.
- ↑ We employed the NMR structure of Geobacter sulfurreducens pilin, 2m7g. We employed model 5 of this 18-conformer ensemble because model 5 had the best clash score and MolProbity score.
- ↑ The Geobacter sequence is identical to the template Pseudomonas sequence in 22 of the first 23 residues. Residues 24-50 have 26% sequence identity.
- ↑ Craig L, Pique ME, Tainer JA. Type IV pilus structure and bacterial pathogenicity. Nat Rev Microbiol. 2004 May;2(5):363-78. PMID:15100690 doi:http://dx.doi.org/10.1038/nrmicro885


