Sandbox Reserved 1661
From Proteopedia
(11 intermediate revisions not shown.) | |||
Line 7: | Line 7: | ||
GH can be regulated by various factors. The hypothalamus secretes hormones, like the GH releasing factor (GHR) or hormone (GHRH) which can stimulate the pituitary cells and activate different signal transduction cascades. On the other hand, it produces the hormone Somatostatin (SS) which inhibits the GH secretion by blocking the [https://en.wikipedia.org/wiki/Adenylyl_cyclase adenylate cyclase (AC)]. However, not the GH expression. It can also prevent the release of GHRH fom the hypthalamus. In addition, can be inhibited by feedback regulation. It stimulates the steroid and thyroid synthesis which migrate back and inhibit GH. Other regulating factors are environmental influences and the nutritional state. [https://doi.org/10.1016/j.ygcen.2017.07.028 ] | GH can be regulated by various factors. The hypothalamus secretes hormones, like the GH releasing factor (GHR) or hormone (GHRH) which can stimulate the pituitary cells and activate different signal transduction cascades. On the other hand, it produces the hormone Somatostatin (SS) which inhibits the GH secretion by blocking the [https://en.wikipedia.org/wiki/Adenylyl_cyclase adenylate cyclase (AC)]. However, not the GH expression. It can also prevent the release of GHRH fom the hypthalamus. In addition, can be inhibited by feedback regulation. It stimulates the steroid and thyroid synthesis which migrate back and inhibit GH. Other regulating factors are environmental influences and the nutritional state. [https://doi.org/10.1016/j.ygcen.2017.07.028 ] | ||
- | <StructureSection load='1HGU' size='350' side='right' scene='' caption='Somatotropin : Growth Hormon([[HGH]])' > | + | <StructureSection load='1HGU' size='350' side='right' scene='' caption='Somatotropin : Growth Hormon ([[HGH]])' > |
== Structure == | == Structure == | ||
Somatotropin has three major isoforms. The predominant form is composed out of 191 amino acids and has a molecular weight of 22 kDa. | Somatotropin has three major isoforms. The predominant form is composed out of 191 amino acids and has a molecular weight of 22 kDa. | ||
- | The '''primary structure''', corresponding to a sequence of amino acids, of the predominant somatotropin | + | The '''primary structure''', corresponding to a [https://www.uniprot.org/uniprot/P01241 sequence of amino acids], of the predominant somatotropin. |
- | FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRI | ||
- | SLLLIQSWLEPVGFLRSVFANQLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKGTYAKFDANSHNDDA | ||
- | LLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF | ||
- | <Structure load='1hgu' size='350' frame='true' align='right' caption='Representation of Somatotropin' /> | ||
Somatotropin does not exist as a linear chain of amino acids, it twists and folds on itself, forming the '''secondary structure'''. The protein, made up of a single chain, consists of four antiparallel aligned <scene name='86/868194/Alpha-helice/2'>α-helices</scene> in an up-up-down-down manner <ref name="Endokrynologika Polska">DOI:10.5603/EP.2013.0009</ref> [https://doi.org/10.1016/j.ghir.2013.02.002]. The first helix starts at the 6th amino acid, which is a leucine and ends with the 37th amino acid proline. It is separated from the other three helices after the 37th position. The 38th and 39th amino acids, which are lysine and glutamic acid are spliced out of the protein and therefore disconnects the first helix from the second one. The second helix starts at position 72 till 92, the third from 106 till 128 and the fourth helix from 154 until 184. All helices are ampipathic with strong <scene name='86/868194/Hydrophobic_regions/1'>hydrophobic regions</scene>, especially helix 2 is very hydrophobic. The [https://en.wikipedia.org/wiki/Hydrophobic_effect#:~:text=Structures%20of%20water%2Dsoluble%20proteins,interact%20with%20surrounding%20water%20molecules. hydrophobic protein core] is usually tigthly packed and any mutations in the hidden positions lead to destablilization <ref name="pubMed">PMID:17584122</ref>. | Somatotropin does not exist as a linear chain of amino acids, it twists and folds on itself, forming the '''secondary structure'''. The protein, made up of a single chain, consists of four antiparallel aligned <scene name='86/868194/Alpha-helice/2'>α-helices</scene> in an up-up-down-down manner <ref name="Endokrynologika Polska">DOI:10.5603/EP.2013.0009</ref> [https://doi.org/10.1016/j.ghir.2013.02.002]. The first helix starts at the 6th amino acid, which is a leucine and ends with the 37th amino acid proline. It is separated from the other three helices after the 37th position. The 38th and 39th amino acids, which are lysine and glutamic acid are spliced out of the protein and therefore disconnects the first helix from the second one. The second helix starts at position 72 till 92, the third from 106 till 128 and the fourth helix from 154 until 184. All helices are ampipathic with strong <scene name='86/868194/Hydrophobic_regions/1'>hydrophobic regions</scene>, especially helix 2 is very hydrophobic. The [https://en.wikipedia.org/wiki/Hydrophobic_effect#:~:text=Structures%20of%20water%2Dsoluble%20proteins,interact%20with%20surrounding%20water%20molecules. hydrophobic protein core] is usually tigthly packed and any mutations in the hidden positions lead to destablilization <ref name="pubMed">PMID:17584122</ref>. | ||
Line 26: | Line 22: | ||
== HGH receptors and interactions == | == HGH receptors and interactions == | ||
- | <Structure load='1hgu' size='350' frame='true' align='right' caption='Representation of Somatotropin' scene='Insert optional scene name here' /> | ||
The [https://en.wikipedia.org/wiki/Growth_hormone_receptor#:~:text=8%20External%20links-,Structure,GH%20binding%20protein%20(GHBP). GH membrane receptor (GHR)] is found on many cells and tissues with the exception of the brain, testicles and thymus. It is part of the [[https://en.wikipedia.org/wiki/Type_I_cytokine_receptor class I cytokine receptor family] [https://doi.org/10.1016/j.ygcen.2017.07.028 ]. The nature of this receptor is not fully understood, but it seems that it may be present in different forms due to different post-translational changes that may occur in a single protein.<ref name="m/s"> Le Cam, A. (1993), Mode d’action de l’hormone de croissance. médecine/sciences, 12:1352-61.[http://www.ipubli.inserm.fr/bitstream/handle/10608/2863/MS_1993_12_1352.pdf?sequence=1]</ref> | The [https://en.wikipedia.org/wiki/Growth_hormone_receptor#:~:text=8%20External%20links-,Structure,GH%20binding%20protein%20(GHBP). GH membrane receptor (GHR)] is found on many cells and tissues with the exception of the brain, testicles and thymus. It is part of the [[https://en.wikipedia.org/wiki/Type_I_cytokine_receptor class I cytokine receptor family] [https://doi.org/10.1016/j.ygcen.2017.07.028 ]. The nature of this receptor is not fully understood, but it seems that it may be present in different forms due to different post-translational changes that may occur in a single protein.<ref name="m/s"> Le Cam, A. (1993), Mode d’action de l’hormone de croissance. médecine/sciences, 12:1352-61.[http://www.ipubli.inserm.fr/bitstream/handle/10608/2863/MS_1993_12_1352.pdf?sequence=1]</ref> | ||
Line 38: | Line 33: | ||
The hormone-binding extracellular domain consists of 250 amino acids, including several cysteine residues which are conserved and can form disulphide bridges.The intracellular domain of the receptor is made up of 350 amino acids, it represents the least conserved region and is made up of 10 tyrosine residues likely to be phosphorylated by tyrosine kinase ([https://en.wikipedia.org/wiki/Janus_kinase_2 JAK2]), during the formation of the GH-receptor complex. A reaction cascade involving kinase enzymes is then activated, allowing the expression of certain genes coding for proteins or not, necessary for biological activity [https://doi.org/10.1016/j.ygcen.2017.07.028 ]. It therefore controls the expression of certain genes such as the gene coding for the IGF-1 factor. The liver and adipose tissue being important targets for GH, it therefore contributes to [https://en.wikipedia.org/wiki/Homeostasis#:~:text=The%20neuroendocrine%20system%20is%20the,hypothalamic%20interconnections%20to%20other%20glands. metabolic homeostasis].<ref name="m/s"/> [https://doi.org/10.1016/j.ygcen.2017.07.028 ] The intercellular domain containing of two box regions. The proline rich first one and an acidic, hydrophobic second one which is connected to receptor internalizing mechanisms [https://doi.org/10.1016/j.ygcen.2017.07.028 ]. | The hormone-binding extracellular domain consists of 250 amino acids, including several cysteine residues which are conserved and can form disulphide bridges.The intracellular domain of the receptor is made up of 350 amino acids, it represents the least conserved region and is made up of 10 tyrosine residues likely to be phosphorylated by tyrosine kinase ([https://en.wikipedia.org/wiki/Janus_kinase_2 JAK2]), during the formation of the GH-receptor complex. A reaction cascade involving kinase enzymes is then activated, allowing the expression of certain genes coding for proteins or not, necessary for biological activity [https://doi.org/10.1016/j.ygcen.2017.07.028 ]. It therefore controls the expression of certain genes such as the gene coding for the IGF-1 factor. The liver and adipose tissue being important targets for GH, it therefore contributes to [https://en.wikipedia.org/wiki/Homeostasis#:~:text=The%20neuroendocrine%20system%20is%20the,hypothalamic%20interconnections%20to%20other%20glands. metabolic homeostasis].<ref name="m/s"/> [https://doi.org/10.1016/j.ygcen.2017.07.028 ] The intercellular domain containing of two box regions. The proline rich first one and an acidic, hydrophobic second one which is connected to receptor internalizing mechanisms [https://doi.org/10.1016/j.ygcen.2017.07.028 ]. | ||
- | == | + | </StructureSection> |
+ | |||
+ | == Disease == | ||
Many diseases can be due to a dysfunction in the secretion of GH. | Many diseases can be due to a dysfunction in the secretion of GH. | ||
Line 45: | Line 42: | ||
[https://en.wikipedia.org/wiki/Gigantism '''Gigantism'''] is characterised by the presence of a high level of GH or IGF-1. This pathology is most often due to an [https://en.wikipedia.org/wiki/Adenoma adenoma] of the pituitary cells, responsible for the production of the hormone [https://en.wikipedia.org/wiki/Growth_hormone%E2%80%93releasing_hormone GHRH], which then stimulates the cells to produce GH in large quantities. It can also be explained by the fact that tissues that do not normally produce GH have tumour cells capable of producing GH. [https://en.wikipedia.org/wiki/Acromegaly '''Acromegaly'''] is when this excess of hormone occurs after puberty.<ref name="bgh"/> | [https://en.wikipedia.org/wiki/Gigantism '''Gigantism'''] is characterised by the presence of a high level of GH or IGF-1. This pathology is most often due to an [https://en.wikipedia.org/wiki/Adenoma adenoma] of the pituitary cells, responsible for the production of the hormone [https://en.wikipedia.org/wiki/Growth_hormone%E2%80%93releasing_hormone GHRH], which then stimulates the cells to produce GH in large quantities. It can also be explained by the fact that tissues that do not normally produce GH have tumour cells capable of producing GH. [https://en.wikipedia.org/wiki/Acromegaly '''Acromegaly'''] is when this excess of hormone occurs after puberty.<ref name="bgh"/> | ||
- | Until 1985, injections of GH were carried out for people suffering from dwarfism. As it could only be obtained by extraction from the pituitary glands of dead people, it could only be extracted in small quantities, so resources were limited. | + | Until 1985, injections of GH were carried out for people suffering from dwarfism. As it could only be obtained by extraction from the pituitary glands of dead people, it could only be extracted in small quantities, so resources were limited. Also this therapeutic treatment has been stopped in many countries, due to the possible contamination of the hormone by [https://en.wikipedia.org/wiki/Prion prions], which can cause serious diseases such as [https://en.wikipedia.org/wiki/Creutzfeldt%E2%80%93Jakob_disease Creutzfeldt-Jakob disease].<ref name="bgh" /> As a result, biosynthetic synthesis of the hormone is carried out by developing [https://en.wikipedia.org/wiki/List_of_recombinant_proteins recombinant proteins] of GH or IGF-1.<ref name="univ"/> |
- | Affected by gigantism pathology, individuals may have therapeutic radiation and therapeutic drug treatment or synthesis of inhibitors such as [https://en.wikipedia.org/wiki/Somatostatin somatostatin], | + | Affected by gigantism pathology, individuals may have therapeutic radiation and therapeutic drug treatment or synthesis of inhibitors such as [https://en.wikipedia.org/wiki/Somatostatin somatostatin], which act as GH antagonists by binding to the receptor, thus preventing the GH to perform its functions.<ref name="bgh"/> |
== References == | == References == | ||
<references/> | <references/> |
Current revision
Somatotropin (GH for Growth Hormone or HGH for Human Growth Hormone) is a polypeptide hormone produced by the somatotropic cells of the pituitary gland. The human growth hormone complex, a protein circulating in the blood, consists of five similiar genes located over a distance of 50 kbp on the long arm of chromosome 17 [1]. There it gets encoded by the Growth hormone 1 gene along with four other related genes (hGH-N, hCS-A, hCS-B, hGH-V [1], [2])[3]. Three of these genes are encoding human chorionic somatomammotropin, which is closely related to somatotropin. They are all in the same transcriptional orientation [2]. GH is one of the best known pleiotropic hormones [4].
Functions
Somatropin plays an important role in physiological environments such as: increasing muscle mass, reducing fat mass, providing the energy necessary for tissue growth, maintaining the right level of glucose and lipids and the development of the individual's body [3]. It acts directly on a cell surface or indirectly. In the second case, somatotropin stimulates tissues such as the liver, which in turn allows the synthesis and secretion of IGF-1, thus enabling the development of cell growth, tissue, bone and thus the linear growth of the individual.[4] The GH regulates direct or indirect anabolic and growth promoting actions. Through direct regulation GH increases the amino acid uptake, the RNA- ,protein- and cartilage-synthesis and muscle growth. These regulations are often mediated by IFG. [5] However, the GH is also able to regulate catabolic actions. Thus it stimulates the breakdown of lipids (lipolysis) as is evident by increased fatty acids. A lack of GH is therefore associated with an increased lipid deposit. [6] GH can be regulated by various factors. The hypothalamus secretes hormones, like the GH releasing factor (GHR) or hormone (GHRH) which can stimulate the pituitary cells and activate different signal transduction cascades. On the other hand, it produces the hormone Somatostatin (SS) which inhibits the GH secretion by blocking the adenylate cyclase (AC). However, not the GH expression. It can also prevent the release of GHRH fom the hypthalamus. In addition, can be inhibited by feedback regulation. It stimulates the steroid and thyroid synthesis which migrate back and inhibit GH. Other regulating factors are environmental influences and the nutritional state. [7]
|
Disease
Many diseases can be due to a dysfunction in the secretion of GH.
Dwarfism is characterized by a lack of GH. The reasons for this deficiency can be explained by many fact, as welle as : a dysfunction during foetal development,The inability of somatotropic cells to synthesize GH, an abnormal structure of the protein, making the connection to the receiver more difficult, geneics mutation ... These factors are then likely to lead to a slowdown in growth, cell, tissue, and bone development.[8]
Gigantism is characterised by the presence of a high level of GH or IGF-1. This pathology is most often due to an adenoma of the pituitary cells, responsible for the production of the hormone GHRH, which then stimulates the cells to produce GH in large quantities. It can also be explained by the fact that tissues that do not normally produce GH have tumour cells capable of producing GH. Acromegaly is when this excess of hormone occurs after puberty.[8]
Until 1985, injections of GH were carried out for people suffering from dwarfism. As it could only be obtained by extraction from the pituitary glands of dead people, it could only be extracted in small quantities, so resources were limited. Also this therapeutic treatment has been stopped in many countries, due to the possible contamination of the hormone by prions, which can cause serious diseases such as Creutzfeldt-Jakob disease.[8] As a result, biosynthetic synthesis of the hormone is carried out by developing recombinant proteins of GH or IGF-1.[9]
Affected by gigantism pathology, individuals may have therapeutic radiation and therapeutic drug treatment or synthesis of inhibitors such as somatostatin, which act as GH antagonists by binding to the receptor, thus preventing the GH to perform its functions.[8]
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Sami AJ. Structure-function relation of somatotropin with reference to molecular modeling. Curr Protein Pept Sci. 2007 Jun;8(3):283-92. doi: 10.2174/138920307780831820. PMID:17584122 doi:http://dx.doi.org/10.2174/138920307780831820
- ↑ Barsh GS, Seeburg PH, Gelinas RE. The human growth hormone gene family: structure and evolution of the chromosomal locus. Nucleic Acids Res. 1983 Jun 25;11(12):3939-58. doi: 10.1093/nar/11.12.3939. PMID:6306568 doi:http://dx.doi.org/10.1093/nar/11.12.3939
- ↑ Reh CS, Geffner ME. Somatotropin in the treatment of growth hormone deficiency and Turner syndrome in pediatric patients: a review. Clin Pharmacol. 2010;2:111-22. doi: 10.2147/CPAA.S6525. Epub 2010 Jun 1. PMID:22291494 doi:http://dx.doi.org/10.2147/CPAA.S6525
- ↑ Utiger, R. D. and other Encyclopedia Britannica Contributors (1998), Insulin-like growth factor. Science, Chemistry.
- ↑ 5.0 5.1 5.2 5.3 Junnila RK, Kopchick JJ. Significance of the disulphide bonds of human growth hormone. Endokrynol Pol. 2013;64(4):300-5. doi: 10.5603/ep.2013.0009. PMID:24002958 doi:http://dx.doi.org/10.5603/ep.2013.0009
- ↑ 6.0 6.1 6.2 6.3 Le Cam, A. (1993), Mode d’action de l’hormone de croissance. médecine/sciences, 12:1352-61.[1]
- ↑ Cunningham BC, Ultsch M, De Vos AM, Mulkerrin MG, Clauser KR, Wells JA. Dimerization of the extracellular domain of the human growth hormone receptor by a single hormone molecule. Science. 1991 Nov 8;254(5033):821-5. doi: 10.1126/science.1948064. PMID:1948064 doi:http://dx.doi.org/10.1126/science.1948064
- ↑ 8.0 8.1 8.2 8.3 Utiger, R.D. and other Encyclopedia Britannica Contributors (1998), Growth hormone. Life cycle, processes & properties encyclopedia articles.
- ↑ Cite error: Invalid
<ref>
tag; no text was provided for refs nameduniv