Mouse Ribonucleotide Reductase R2
From Proteopedia
(Difference between revisions)
| Line 1: | Line 1: | ||
| - | + | ==Mouse Ribonucleotide Reductase R2== | |
| - | + | <StructureSection load='1dq8' size='500' side='right' caption='Structure of HMG-CoA reductase (PDB entry [[1dq8]])' scene=''> | |
| - | + | ||
| - | + | ||
| - | < | + | |
| - | + | ||
| - | + | ||
| - | + | ||
| - | + | ||
Mouse ribonucleotide reductase is a class I enzyme. Class I enzymes consist of two different subunits. These two subunits are connected via hydrogen bonds. This enzyme acts primarily to catalyze the reduction of nucleoside diphosphates to deoxynucleoside diphosphates. Within DNA synthesis, this is the first dedicated step. The R2 subunit, a homodimer, is the smaller of the two subunits in this enzyme and serves as a limiting agent for overall enzyme activity. This subunit acts to maintain the tyrosil radical neighboring a diiron carboxylate site. In the mouse R2 subunit, the tyrosine residue is Tyr177. Through the process of catalysis, it has been proposed that the oxidation equivalent stored in the tyrosil subunit is passed along a pathway to a cysteine residue at an active site. Both subunits act as electron transfer pathways to the iron site. An arginine residue, Arg 265, has proven to be key to the activity of this particular enzyme. <ref>http://www.jbc.org/cgi/content/full/281/36/26022</ref> | Mouse ribonucleotide reductase is a class I enzyme. Class I enzymes consist of two different subunits. These two subunits are connected via hydrogen bonds. This enzyme acts primarily to catalyze the reduction of nucleoside diphosphates to deoxynucleoside diphosphates. Within DNA synthesis, this is the first dedicated step. The R2 subunit, a homodimer, is the smaller of the two subunits in this enzyme and serves as a limiting agent for overall enzyme activity. This subunit acts to maintain the tyrosil radical neighboring a diiron carboxylate site. In the mouse R2 subunit, the tyrosine residue is Tyr177. Through the process of catalysis, it has been proposed that the oxidation equivalent stored in the tyrosil subunit is passed along a pathway to a cysteine residue at an active site. Both subunits act as electron transfer pathways to the iron site. An arginine residue, Arg 265, has proven to be key to the activity of this particular enzyme. <ref>http://www.jbc.org/cgi/content/full/281/36/26022</ref> | ||
==Activity Within DNA Synthesis== | ==Activity Within DNA Synthesis== | ||
| Line 13: | Line 6: | ||
==Structual Properties== | ==Structual Properties== | ||
While both forms of this enzyme both interact with iron, there are some structural differences due to the different conditions. | While both forms of this enzyme both interact with iron, there are some structural differences due to the different conditions. | ||
| + | |||
| + | <scene name='Sandbox_46/1w68/2'>1w68 (under oxidizing conditions)</scene> | ||
| + | |||
| + | <scene name='Sandbox_46/1w69/2'>1w69 (under reducing conditions)</scene><ref>http://blast.ncbi.nlm.nih.gov/Blast.cgi</ref> | ||
1w68: | 1w68: | ||
| Line 38: | Line 35: | ||
CLMFKHLVHKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR | CLMFKHLVHKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR | ||
VENPF<ref>http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/</ref> | VENPF<ref>http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/</ref> | ||
| - | + | </StructureSection> | |
==References== | ==References== | ||
<references/> | <references/> | ||
Revision as of 03:24, 6 March 2012
Mouse Ribonucleotide Reductase R2
| |||||||||||
References
- ↑ http://www.jbc.org/cgi/content/full/281/36/26022
- ↑ http://www.jbc.org/cgi/content/full/279/11/10796
- ↑ http://blast.ncbi.nlm.nih.gov/Blast.cgi
- ↑ http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/
- ↑ http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/
BLAST: Basic Local Alignment Search Tool, National Center for Biotechnology Information
Gräslund A, Narváez AJ, Thelander L, Voevodskaya N. 2006 "The Involvement of Arg265 of Mouse Ribonucleotide Reductase R2 Protein in Proton Transfer and Catalysis." J. Biol. Chem., 281(36): 26022-26028.
Björklund S, Chabes AL, Thelander L. 2004 "S Phase-specific Transcription of the Mouse Ribonucleotide Reductase R2 Gene Requires Both a Proximal Repressive E2F-binding Site and an Upstream Promoter Activating Region." J. Biol. Chem., 279(11): 10796-10807.
PDBSum: European Bioinformatics Institution

