We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.

Sandbox chameleon

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 7: Line 7:
Display this IgG-Binding domain in <scene name='61/611439/Rainbow_cartoon/1'>Rainbow Ribbon</scene>
Display this IgG-Binding domain in <scene name='61/611439/Rainbow_cartoon/1'>Rainbow Ribbon</scene>
''i.e.'' going from Blue---Red from N--->C terminal. Simply things with all coloured in <scene name='61/611439/Cartoon_beige/1'>beige</scene>
''i.e.'' going from Blue---Red from N--->C terminal. Simply things with all coloured in <scene name='61/611439/Cartoon_beige/1'>beige</scene>
-
Now display the structure mutated structure where 5 amino acids, in region <scene name='61/611439/Cartoon_pink_23-33/1'>23-33</scene>, were change
+
Now display the structure mutated structure where 5 amino acids, in this region <scene name='61/611439/Cartoon_pink_23-33/1'>23-33</scene>, were change to the Chameleon sequence, i.e. '''AWTVEKAFKTF'''
i.e. going from:
i.e. going from:
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK
TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK
 +
 +

Revision as of 15:58, 30 November 2014

Your Heading Here (maybe something like 'Structure')

2gb1

Drag the structure with the mouse to rotate

References

  1. Hanson, R. M., Prilusky, J., Renjian, Z., Nakane, T. and Sussman, J. L. (2013), JSmol and the Next-Generation Web-Based Representation of 3D Molecular Structure as Applied to Proteopedia. Isr. J. Chem., 53:207-216. doi:http://dx.doi.org/10.1002/ijch.201300024
  2. Herraez A. Biomolecules in the computer: Jmol to the rescue. Biochem Mol Biol Educ. 2006 Jul;34(4):255-61. doi: 10.1002/bmb.2006.494034042644. PMID:21638687 doi:10.1002/bmb.2006.494034042644
Personal tools