We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.
Sandbox chameleon
From Proteopedia
(Difference between revisions)
| Line 12: | Line 12: | ||
TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK | TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK | ||
| + | If a similar change from the Wild-Type to 5 amino acids, in the region <scene name='61/611439/Cartoon_pink_42-52/1'>42-52</scene> | ||
| + | </StructureSection> are changed to the Chameleon sequence, | ||
| + | i.e. going from: | ||
| + | TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK | ||
| + | TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG'''AWTVEKAFKTF'''TVTEK | ||
| - | |||
| - | 23-33 | ||
| - | <scene name='61/611439/Cartoon_pink_23-33/1'>23-33 Pink</scene> | ||
| - | |||
| - | 42-52 | ||
| - | <scene name='61/611439/Cartoon_pink_42-52/1'>42-52 Pink</scene> | ||
</StructureSection> | </StructureSection> | ||
== References == | == References == | ||
<references/> | <references/> | ||
Revision as of 16:01, 30 November 2014
Your Heading Here (maybe something like 'Structure')
| |||||||||||
i.e. going from:
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGAWTVEKAFKTFTVTEK
</StructureSection>
References
- ↑ Hanson, R. M., Prilusky, J., Renjian, Z., Nakane, T. and Sussman, J. L. (2013), JSmol and the Next-Generation Web-Based Representation of 3D Molecular Structure as Applied to Proteopedia. Isr. J. Chem., 53:207-216. doi:http://dx.doi.org/10.1002/ijch.201300024
- ↑ Herraez A. Biomolecules in the computer: Jmol to the rescue. Biochem Mol Biol Educ. 2006 Jul;34(4):255-61. doi: 10.1002/bmb.2006.494034042644. PMID:21638687 doi:10.1002/bmb.2006.494034042644
