Sandbox chameleon
From Proteopedia
(Difference between revisions)
| Line 6: | Line 6: | ||
== Function == | == Function == | ||
Display this IgG-Binding domain in <scene name='61/611439/Rainbow_cartoon/1'>Rainbow Ribbon</scene> | Display this IgG-Binding domain in <scene name='61/611439/Rainbow_cartoon/1'>Rainbow Ribbon</scene> | ||
| - | ''i.e.'' going from Blue---Red from N--->C terminal. | + | ''i.e.'' going from Blue---Red from N--->C terminal. To simplify things entire chain is colored <scene name='61/611439/Cartoon_beige/1'>beige</scene>. |
| - | + | Displaying the structure mutated structure, where 5 amino acids, in this region <scene name='61/611439/Cartoon_pink_23-33/1'>23-33</scene>, are change to the Chameleon sequence, i.e. '''AWTVEKAFKTF''' | |
i.e. going from: | i.e. going from: | ||
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK | TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK | ||
Revision as of 16:02, 30 November 2014
Your Heading Here (maybe something like 'Structure')
| |||||||||||
i.e. going from:
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGAWTVEKAFKTFTVTEK
</StructureSection>
References
- ↑ Hanson, R. M., Prilusky, J., Renjian, Z., Nakane, T. and Sussman, J. L. (2013), JSmol and the Next-Generation Web-Based Representation of 3D Molecular Structure as Applied to Proteopedia. Isr. J. Chem., 53:207-216. doi:http://dx.doi.org/10.1002/ijch.201300024
- ↑ Herraez A. Biomolecules in the computer: Jmol to the rescue. Biochem Mol Biol Educ. 2006 Jul;34(4):255-61. doi: 10.1002/bmb.2006.494034042644. PMID:21638687 doi:10.1002/bmb.2006.494034042644
