We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.

Sandbox chameleon

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 5: Line 5:
Methodology: Design the longest possible sequence that can fold into an alpha-helix when inserted into one place in a protein sequence and a beta-sheet when inserted into another
Methodology: Design the longest possible sequence that can fold into an alpha-helix when inserted into one place in a protein sequence and a beta-sheet when inserted into another
-
 
+
You may include any references to papers as in: the use of JSmol in Proteopedia or to the article describing Jmol <ref>PMID:8614471</ref> to the rescue.
-
<ref>PMID:8614471</ref> or to the article describing Jmol <ref>PMID:21638687</ref> to the rescue.
+
== Function ==
== Function ==

Revision as of 16:07, 30 November 2014

Your Heading Here (maybe something like 'Structure')

2gb1

Drag the structure with the mouse to rotate
are changed to the Chameleon sequence,

i.e. going from:

TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGAWTVEKAFKTFTVTEK


</StructureSection>

References

  1. Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
Personal tools