Sandbox chameleon
From Proteopedia
(Difference between revisions)
| Line 1: | Line 1: | ||
==Does the amino acid sequence ''really'' determine the 3D structure of a peptide?')== | ==Does the amino acid sequence ''really'' determine the 3D structure of a peptide?')== | ||
<StructureSection load='2gb1' size='340' side='right' caption='2gb1' scene='61/611439/Rainbow_cartoon/1'> | <StructureSection load='2gb1' size='340' side='right' caption='2gb1' scene='61/611439/Rainbow_cartoon/1'> | ||
| - | General question | + | ==General question== |
| + | To determine the extent to which non-local factors influence the formation of secondary structural elements | ||
| - | Methodology | + | ==Methodology== |
| + | Design the longest possible sequence that can fold into an alpha-helix when inserted into one place in a protein sequence and a beta-sheet when inserted into another | ||
Two key references to read on this ones on a ''Chameleon'' peptide<ref>PMID:8614471</ref> and an analysis of Helix-to-Strand Transition Between Peptides with Identical Sequences<ref>PMID:10966577 </ref>. | Two key references to read on this ones on a ''Chameleon'' peptide<ref>PMID:8614471</ref> and an analysis of Helix-to-Strand Transition Between Peptides with Identical Sequences<ref>PMID:10966577 </ref>. | ||
| - | == | + | == Seeing is believing == |
Display this IgG-Binding domain in <scene name='61/611439/Rainbow_cartoon/1'>Rainbow Ribbon</scene> | Display this IgG-Binding domain in <scene name='61/611439/Rainbow_cartoon/1'>Rainbow Ribbon</scene> | ||
''i.e.'' going from Blue---Red from N--->C terminal. To simplify things entire chain is colored <scene name='61/611439/Cartoon_beige/1'>beige</scene>. | ''i.e.'' going from Blue---Red from N--->C terminal. To simplify things entire chain is colored <scene name='61/611439/Cartoon_beige/1'>beige</scene>. | ||
Revision as of 16:13, 30 November 2014
Does the amino acid sequence really determine the 3D structure of a peptide?')
| |||||||||||
i.e. going from:
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGAWTVEKAFKTFTVTEK
</StructureSection>
References
- ↑ Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
- ↑ Zhou X, Alber F, Folkers G, Gonnet GH, Chelvanayagam G. An analysis of the helix-to-strand transition between peptides with identical sequence. Proteins. 2000 Nov 1;41(2):248-56. PMID:10966577
