Sandbox chameleon

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 10: Line 10:
== Seeing is believing ==
== Seeing is believing ==
-
Display this IgG-Binding domain in <scene name='61/611439/Rainbow_cartoon/1'>Rainbow Ribbon</scene>
+
The IgG-Binding domain is displayed in Rainbow colors, ''i.e.'' going from Blue--->Red from N--->C terminal.
-
''i.e.'' going from Blue---Red from N--->C terminal. To simplify things entire chain is colored <scene name='61/611439/Cartoon_beige/1'>beige</scene>.
+
To simplify things, the entire chain is colored <scene name='61/611439/Cartoon_beige/1'>beige</scene>.
-
Displaying the structure mutated structure, where 5 amino acids, in this region <scene name='61/611439/Cartoon_pink_23-33/1'>23-33</scene>, are change to the Chameleon sequence, i.e. '''AWTVEKAFKTF'''
+
 
-
i.e. going from:
+
Now displaying the mutated structure, where 5 amino acids, in the region <scene name='61/611439/Cartoon_pink_23-33/1'>23-33</scene>, are change to the ''Chameleon'' sequence, i.e. '''AWTVEKAFKTF'''
-
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
+
specifically:
-
TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK
+
From: TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
 +
To: TTYKLILNGKTLKGETTTEAVD'''AWTVEKAFKTF'''ANDNGVDGEWTYDDATKTFTVTEK

Revision as of 16:18, 30 November 2014

Does the amino acid sequence really determine the 3D structure of a peptide?')

2gb1

Drag the structure with the mouse to rotate

References

  1. ↑ Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
  2. ↑ Zhou X, Alber F, Folkers G, Gonnet GH, Chelvanayagam G. An analysis of the helix-to-strand transition between peptides with identical sequence. Proteins. 2000 Nov 1;41(2):248-56. PMID:10966577
Retrieved from "http://52.214.119.220/wiki/index.php/Sandbox_chameleon"
Personal tools