This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


1stp

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 7: Line 7:
|ACTIVITY=
|ACTIVITY=
|GENE=
|GENE=
 +
|DOMAIN=<span class='plainlinks'>[http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid= Avidin]</span>
 +
|RESOURCES=<span class='plainlinks'>[http://oca.weizmann.ac.il/oca-docs/fgij/fg.htm?mol=1stp FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=1stp OCA], [http://www.ebi.ac.uk/pdbsum/1stp PDBsum], [http://www.fli-leibniz.de/cgi-bin/ImgLib.pl?CODE=1kfv JenaLib], [http://www.rcsb.org/pdb/explore.do?structureId=1stp RCSB]</span>
}}
}}
Line 16: Line 18:
==About this Structure==
==About this Structure==
-
1STP is a [[Single protein]] structure of sequence from [http://en.wikipedia.org/wiki/Streptomyces_avidinii Streptomyces avidinii]. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=1STP OCA].
+
1STP is a [[Single protein]] structure of sequence from [http://en.wikipedia.org/wiki/Streptomyces_avidinii Streptomyces avidinii].
 +
{| class="toccolours collapsible collapsed" width=80%
 +
|-
 +
! colspan="2" | Sequence and Crystal Information |-
 +
|Sequence||DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
 +
|}
 +
Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=1STP OCA].
==Reference==
==Reference==
Line 24: Line 32:
[[Category: Salemme, F R.]]
[[Category: Salemme, F R.]]
[[Category: Weber, P C.]]
[[Category: Weber, P C.]]
-
[[Category: BTN]]
 
[[Category: biotin binding protein]]
[[Category: biotin binding protein]]
-
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Thu Mar 20 14:09:31 2008''
+
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Sat Mar 29 23:15:18 2008''

Revision as of 20:15, 29 March 2008


PDB ID 1stp

Drag the structure with the mouse to rotate
, resolution 2.6Å
Ligands:
Domains: Avidin
Resources: FirstGlance, OCA, PDBsum, JenaLib, RCSB
Coordinates: save as pdb, mmCIF, xml



STRUCTURAL ORIGINS OF HIGH-AFFINITY BIOTIN BINDING TO STREPTAVIDIN


Overview

The high affinity of the noncovalent interaction between biotin and streptavidin forms the basis for many diagnostic assays that require the formation of an irreversible and specific linkage between biological macromolecules. Comparison of the refined crystal structures of apo and a streptavidin:biotin complex shows that the high affinity results from several factors. These factors include the formation of multiple hydrogen bonds and van der Waals interactions between biotin and the protein, together with the ordering of surface polypeptide loops that bury the biotin in the protein interior. Structural alterations at the biotin binding site produce quaternary changes in the streptavidin tetramer. These changes apparently propagate through cooperative deformations in the twisted beta sheets that link tetramer subunits.

About this Structure

1STP is a Single protein structure of sequence from Streptomyces avidinii.

Full crystallographic information is available from OCA.

Reference

Structural origins of high-affinity biotin binding to streptavidin., Weber PC, Ohlendorf DH, Wendoloski JJ, Salemme FR, Science. 1989 Jan 6;243(4887):85-8. PMID:2911722

Page seeded by OCA on Sat Mar 29 23:15:18 2008

Proteopedia Page Contributors and Editors (what is this?)

OCA

Personal tools