User:Nikhil Malvankar/Geobacter pilus
From Proteopedia
(Difference between revisions)
												
			
			| Line 34: | Line 34: | ||
| <br><hr><br> | <br><hr><br> | ||
| - | == | + | ==Download== | 
| + | ===Pilus Model=== | ||
| * Click to download [http://proteopedia.org/wiki/images/e/e4/Geobacter_Pilus_Pseuodmonas_template_homology_monomer.pdb Geobacter sulfurreducens pilus homology model templated on Pseudomonas pilus model]. | * Click to download [http://proteopedia.org/wiki/images/e/e4/Geobacter_Pilus_Pseuodmonas_template_homology_monomer.pdb Geobacter sulfurreducens pilus homology model templated on Pseudomonas pilus model]. | ||
| + | ===Animations for Powerpoint=== | ||
| + | Click images to see them full size, or to download them. | ||
| + | * [[Image:Geobacter pilus assembling animation.gif|300px|Pilus Assembly]] | ||
| ==Notes & References== | ==Notes & References== | ||
| <references /> | <references /> | ||
Revision as of 22:50, 28 February 2015
Interactive 3D Complement in Proteopedia

Structural basis for metallic-like conductivity in microbial nanowires.
Nikhil S. Malvankar, Madeline Vargas, Kelly Nevin, Pier-Luc Tremblay, Kenneth Evans-Lutterodt, Dmytro Nykypanchuk, Eric Martz, Mark T. Tuominen, Derek R. Lovley. mBio 6 in press (2015). 
| Contents | 
Molecular Tour
| 
 | |||||||||||
Download
Pilus Model
- Click to download Geobacter sulfurreducens pilus homology model templated on Pseudomonas pilus model.
Animations for Powerpoint
Click images to see them full size, or to download them.
Notes & References
- ↑ A Geobacter sulfurreducens pilin (pilA) homology model was constructed by Swiss-Model, templated on the X-ray crystallographic structure of Pseudomonas aeruginosa pilin (1oqw, chain A). This model represents residues 1-60 of the mature pilin protein (length 61 amino acids: residues 30-90 of D7AIT1), sequence FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES. This monomer includes six aromatic residues, F1, F24, Y27, Y32, F51 and Y57.
- ↑ We employed the NMR structure of Geobacter sulfurreducens pilin, 2m7g. We employed model 5 of this 18-conformer ensemble because model 5 had the best clash score and MolProbity score.
- ↑ The Geobacter sequence is identical to the template Pseudomonas sequence in 22 of the first 23 residues. Residues 24-50 have 26% sequence identity.
- ↑ Craig L, Pique ME, Tainer JA. Type IV pilus structure and bacterial pathogenicity. Nat Rev Microbiol. 2004 May;2(5):363-78. PMID:15100690 doi:http://dx.doi.org/10.1038/nrmicro885



