This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.
Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.
Sandbox Reserved 1125
From Proteopedia
| Line 25: | Line 25: | ||
== Structure and domains == | == Structure and domains == | ||
MMP8 is composed of several domains: a propeptide, a catalytic domain, a hinge region, and a C-terminal hemopexinlike domain.<ref name="Pdf">[https://www.google.fr/url?sa=t&rct=j&q=&esrc=s&source=web&cd=5&cad=rja&uact=8&ved=0ahUKEwipxN6imszKAhVCPxoKHR5QDC4QFghFMAQ&url=http%3A%2F%2Fwww.springer.com%2Fcda%2Fcontent%2Fdocument%2Fcda_downloaddocument%2F9780896036680-c2.pdf%3FSGWID%3D0-0-45-494797-p173728219&usg=AFQjCNHRfP-tVHWXP2ljUTd3MjjhObqnCA&sig2=6RnjnFvqo7PVhxvSDDsOlw Substrate specificity of MMPs]</ref> | MMP8 is composed of several domains: a propeptide, a catalytic domain, a hinge region, and a C-terminal hemopexinlike domain.<ref name="Pdf">[https://www.google.fr/url?sa=t&rct=j&q=&esrc=s&source=web&cd=5&cad=rja&uact=8&ved=0ahUKEwipxN6imszKAhVCPxoKHR5QDC4QFghFMAQ&url=http%3A%2F%2Fwww.springer.com%2Fcda%2Fcontent%2Fdocument%2Fcda_downloaddocument%2F9780896036680-c2.pdf%3FSGWID%3D0-0-45-494797-p173728219&usg=AFQjCNHRfP-tVHWXP2ljUTd3MjjhObqnCA&sig2=6RnjnFvqo7PVhxvSDDsOlw Substrate specificity of MMPs]</ref> | ||
| - | Thanks to X-ray crystallography, its structure has been solved with 1,7 Å resolution (2OY4). | ||
| - | |||
| - | |||
=== Propeptide === | === Propeptide === | ||
It corresponds to <scene name='71/719866/Activation_peptide/2'>79 aminoacids</scene>, from Phe21 to Met100. | It corresponds to <scene name='71/719866/Activation_peptide/2'>79 aminoacids</scene>, from Phe21 to Met100. | ||
The sequence of residue is: FPVSSKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFM | The sequence of residue is: FPVSSKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFM | ||
| - | |||
| - | |||
| - | |||
| - | |||
=== Pocket interaction === | === Pocket interaction === | ||
| Line 41: | Line 34: | ||
[[Image:CA_pocket_interaction.gif | thumb|CA pocket interaction]]This enzyme binds 3 Ca ions, 2 of them in the catalytic domain. | [[Image:CA_pocket_interaction.gif | thumb|CA pocket interaction]]This enzyme binds 3 Ca ions, 2 of them in the catalytic domain. | ||
The residues involved in the Ca996 interactions (coordinate bonds) are <scene name='71/719866/Ca2_interactions/1'>two Gly residues (169 and 171) next to two Asp residues (137 and 173)</scene>. | The residues involved in the Ca996 interactions (coordinate bonds) are <scene name='71/719866/Ca2_interactions/1'>two Gly residues (169 and 171) next to two Asp residues (137 and 173)</scene>. | ||
| - | |||
| - | |||
==== Zn2+ ==== | ==== Zn2+ ==== | ||
| Line 54: | Line 45: | ||
<font color='red'>The conserved cysteine present in the cysteine-switch motif (89-96) binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.</font> | <font color='red'>The conserved cysteine present in the cysteine-switch motif (89-96) binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.</font> | ||
| - | |||
=== Catalytic domain === | === Catalytic domain === | ||
| - | This domain is composed of 163 residues, from Met80 to Gly242, organized in <scene name='71/719866/Helixes/3'>three alpha helixes</scene> and <scene name='71/719866/Sheets/2'>five beta sheets</scene>. | + | This domain is composed of 163 residues, from Met80 to Gly242, organized in <scene name='71/719866/Helixes/3'>three alpha helixes</scene> and <scene name='71/719866/Sheets/2'>five beta sheets</scene>. Thanks to X-ray crystallography, its structure has been solved with 1,7 Å resolution (2OY4). |
(http://www.ncbi.nlm.nih.gov/pmc/articles/PMC394940/?page=1). The catalytic zinc ion is situated at the bottom of the active-site. The other zinc ion and the two calcium ions are packed against the top of the beta sheet and presumably function to stabilize the catalytic domain. The polypeptide folding and in particular the zinc environment of the collagenase catalytic domain bear a close ressemblance to the astacins and the snake venom metalloproteinases. | (http://www.ncbi.nlm.nih.gov/pmc/articles/PMC394940/?page=1). The catalytic zinc ion is situated at the bottom of the active-site. The other zinc ion and the two calcium ions are packed against the top of the beta sheet and presumably function to stabilize the catalytic domain. The polypeptide folding and in particular the zinc environment of the collagenase catalytic domain bear a close ressemblance to the astacins and the snake venom metalloproteinases. | ||
The catalytic domain alone has proteolytic activity against other protein substrates and synthetic substrates. | The catalytic domain alone has proteolytic activity against other protein substrates and synthetic substrates. | ||
Revision as of 16:52, 28 January 2016
MMP8
MMP-8, also called, Neutrophil collagenase or Collagenase 2, is a zinc-dependent and calcium-dependent enzyme. It belongs to the matrix metalloproteinase (MMP) family which is involved in the breakdown of extracellular matrix in embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The gene coding this family is localized on the chromosome 11 of Homo sapiens .[1]
| |||||||||||
References
- ↑ "MMP8 matrix metallopeptidase 8 (neutrophil collagenase)"
- ↑ Stams T, Spurlino JC, Smith DL, Wahl RC, Ho TF, Qoronfleh MW, Banks TM, Rubin B. Structure of human neutrophil collagenase reveals large S1' specificity pocket. Nat Struct Biol. 1994 Feb;1(2):119-23. PMID:7656015
- ↑ 3.0 3.1 Substrate specificity of MMPs
- ↑ Hirose T, Patterson C, Pourmotabbed T, Mainardi CL, Hasty KA. Structure-function relationship of human neutrophil collagenase: identification of regions responsible for substrate specificity and general proteinase activity. Proc Natl Acad Sci U S A. 1993 Apr 1;90(7):2569-73. PMID:8464863
- ↑ Knauper V, Osthues A, DeClerck YA, Langley KE, Blaser J, Tschesche H. Fragmentation of human polymorphonuclear-leucocyte collagenase. Biochem J. 1993 May 1;291 ( Pt 3):847-54. PMID:8489511
- ↑ Welgus HG, Jeffrey JJ, Eisen AZ. Human skin fibroblast collagenase. Assessment of activation energy and deuterium isotope effect with collagenous substrates. J Biol Chem. 1981 Sep 25;256(18):9516-21. PMID:6270090
- ↑ Knauper V, Docherty AJ, Smith B, Tschesche H, Murphy G. Analysis of the contribution of the hinge region of human neutrophil collagenase (HNC, MMP-8) to stability and collagenolytic activity by alanine scanning mutagenesis. FEBS Lett. 1997 Mar 17;405(1):60-4. PMID:9094424
- ↑ "Neutrophil collagenase"
- ↑ "Metalloendopeptidase activity"
- ↑ "Extra Binding Region Induced by Non-Zinc Chelating Inhibitors into the S1′ Subsite of Matrix Metalloproteinase 8"
- ↑ Balbin M, Fueyo A, Knauper V, Pendas AM, Lopez JM, Jimenez MG, Murphy G, Lopez-Otin C. Collagenase 2 (MMP-8) expression in murine tissue-remodeling processes. Analysis of its potential role in postpartum involution of the uterus. J Biol Chem. 1998 Sep 11;273(37):23959-68. PMID:9727011
RESSOURCE : Image:2oy4 mm1.pdb ( la structure du monomère )
