This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


Sandbox Reserved 1228

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 14: Line 14:
<b> Subunit B </b>
<b> Subunit B </b>
-
<br>
+
<br> 1ECI.B has a 34 amino acid peptide sequence as followed: WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK
-
1ECI.B has a 34 amino acid peptide sequence as followed: WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK
+

Revision as of 21:54, 26 April 2017

ECTATOMIN 1ECI

PDB ID 1eci

Drag the structure with the mouse to rotate
Personal tools