2jr8
From Proteopedia
| Line 1: | Line 1: | ||
[[Image:2jr8.jpg|left|200px]] | [[Image:2jr8.jpg|left|200px]] | ||
| - | + | <!-- | |
| - | + | The line below this paragraph, containing "STRUCTURE_2jr8", creates the "Structure Box" on the page. | |
| - | + | You may change the PDB parameter (which sets the PDB file loaded into the applet) | |
| - | + | or the SCENE parameter (which sets the initial scene displayed when the page is loaded), | |
| - | + | or leave the SCENE parameter empty for the default display. | |
| - | + | --> | |
| - | + | {{STRUCTURE_2jr8| PDB=2jr8 | SCENE= }} | |
| - | | | + | |
| - | | | + | |
| - | }} | + | |
'''Solution structure of Manduca sexta moricin''' | '''Solution structure of Manduca sexta moricin''' | ||
| Line 19: | Line 16: | ||
==About this Structure== | ==About this Structure== | ||
| - | 2JR8 is a [[Single protein]] structure | + | 2JR8 is a [[Single protein]] structure. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2JR8 OCA]. |
==Reference== | ==Reference== | ||
| Line 30: | Line 27: | ||
[[Category: Prakash, O.]] | [[Category: Prakash, O.]] | ||
[[Category: Rayaprolu, S.]] | [[Category: Rayaprolu, S.]] | ||
| - | [[Category: | + | [[Category: Antimicrobial peptide]] |
| - | [[Category: | + | [[Category: Antimicrobial protein]] |
| - | + | ''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Sun May 4 09:12:48 2008'' | |
| - | ''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on | + | |
Revision as of 06:12, 4 May 2008
Solution structure of Manduca sexta moricin
Overview
In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional (1)H--(1)H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. Copyright (c) 2008 European Peptide Society and John Wiley & Sons, Ltd.
About this Structure
2JR8 is a Single protein structure. Full crystallographic information is available from OCA.
Reference
Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin., Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H, J Pept Sci. 2008 Feb 11;. PMID:18265434 Page seeded by OCA on Sun May 4 09:12:48 2008
