We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.

2jr8

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 1: Line 1:
[[Image:2jr8.jpg|left|200px]]
[[Image:2jr8.jpg|left|200px]]
-
{{Structure
+
<!--
-
|PDB= 2jr8 |SIZE=350|CAPTION= <scene name='initialview01'>2jr8</scene>
+
The line below this paragraph, containing "STRUCTURE_2jr8", creates the "Structure Box" on the page.
-
|SITE=
+
You may change the PDB parameter (which sets the PDB file loaded into the applet)
-
|LIGAND=
+
or the SCENE parameter (which sets the initial scene displayed when the page is loaded),
-
|ACTIVITY=
+
or leave the SCENE parameter empty for the default display.
-
|GENE=
+
-->
-
|DOMAIN=<span class='plainlinks'>[http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=pfam06451 Moricin]</span>
+
{{STRUCTURE_2jr8| PDB=2jr8 | SCENE= }}
-
|RELATEDENTRY=
+
-
|RESOURCES=<span class='plainlinks'>[http://oca.weizmann.ac.il/oca-docs/fgij/fg.htm?mol=2jr8 FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=2jr8 OCA], [http://www.ebi.ac.uk/pdbsum/2jr8 PDBsum], [http://www.rcsb.org/pdb/explore.do?structureId=2jr8 RCSB]</span>
+
-
}}
+
'''Solution structure of Manduca sexta moricin'''
'''Solution structure of Manduca sexta moricin'''
Line 19: Line 16:
==About this Structure==
==About this Structure==
-
2JR8 is a [[Single protein]] structure of sequence from [http://en.wikipedia.org/wiki/ ]. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2JR8 OCA].
+
2JR8 is a [[Single protein]] structure. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2JR8 OCA].
==Reference==
==Reference==
Line 30: Line 27:
[[Category: Prakash, O.]]
[[Category: Prakash, O.]]
[[Category: Rayaprolu, S.]]
[[Category: Rayaprolu, S.]]
-
[[Category: antimicrobial peptide]]
+
[[Category: Antimicrobial peptide]]
-
[[Category: antimicrobial protein]]
+
[[Category: Antimicrobial protein]]
-
 
+
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Sun May 4 09:12:48 2008''
-
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Mon Mar 31 04:01:03 2008''
+

Revision as of 06:12, 4 May 2008

Template:STRUCTURE 2jr8

Solution structure of Manduca sexta moricin


Overview

In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional (1)H--(1)H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. Copyright (c) 2008 European Peptide Society and John Wiley & Sons, Ltd.

About this Structure

2JR8 is a Single protein structure. Full crystallographic information is available from OCA.

Reference

Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin., Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H, J Pept Sci. 2008 Feb 11;. PMID:18265434 Page seeded by OCA on Sun May 4 09:12:48 2008

Proteopedia Page Contributors and Editors (what is this?)

OCA

Personal tools