Sandbox Reserved 1099
From Proteopedia
| Line 18: | Line 18: | ||
DCD full-length sequence : | DCD full-length sequence : | ||
| - | + | ''MRFMTLLFLTALAGALVCA''YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQR'''SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL''' | |
However, some clivage of the precursor occurred probably in sweat to produce different active forms of dermcidin peptide. The most abundant proteolytically processed DCD peptide presents in sweat is '''DCD-1L'''. | However, some clivage of the precursor occurred probably in sweat to produce different active forms of dermcidin peptide. The most abundant proteolytically processed DCD peptide presents in sweat is '''DCD-1L'''. | ||
Revision as of 14:11, 16 January 2020
| This Sandbox is Reserved from 25/11/2019, through 30/9/2020 for use in the course "Structural Biology" taught by Bruno Kieffer at the University of Strasbourg, ESBS. This reservation includes Sandbox Reserved 1091 through Sandbox Reserved 1115. |
To get started:
More help: Help:Editing |
Dermcidin is a Human antimicrobial, anionic and ion membrane channel (2YMK) discovered in 2001 based on 6 dermcidin antimicrobial peptides of 110 amino acids present in sweat. These peptides, encoded by the DCD gene, play a role in the host defense system as a trimeric channel and thus, are able to prevent infection after injuries or any skin disorders. Scientists are focused on this molecule due to his charge particularity and since antibiotic resistances have been observed.
Contents |
Homology
The dermcidin peptide sequence has no homology with other known antimicrobial peptide(shortened to AMP). There are two types of AMP, the anionic antimicrobial peptide (AAMP) or the cationic one (CAMP). These two AMP are completing themselves as they are at their best activities in different conditions. Despite AAMP are rare and infrequent in Human, the dermicidin is the one of the most analysed AAMP.
Two classes of mammalian and cationic antimicrobial peptides exist :
- Cathelicidins
- Defensins (α-defensins and β-defensins)
But, some size and structural similarities can be found with the defensin family. [1]
Expression and maturation
Dermcidin gene (DCD gene) is located on the chromosome 12 and constitutively expressed as precursor of 110 amino acids only in mucous cells of eccrine sweat glands within the dermis of the skin. The molecular weight of the DCD full-length sequence is 9.3 kDa including the signal peptide. The peptide is then secreted by granules in sweat and transported on the epidermal surface.
DCD full-length sequence : MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
However, some clivage of the precursor occurred probably in sweat to produce different active forms of dermcidin peptide. The most abundant proteolytically processed DCD peptide presents in sweat is DCD-1L.
DCD-1L is created by proteases in sweat after the first post-secretory processing step consisting to reduce the peptide to the C-terminal thereupon containing 48 residues, from the 63 to the 110 amino acid. And secondly, the cathepsin D with 1,10-phenthroline-sensitive carboxypeptidase still not cited in sweat composition yet and an unidentified endoprotease contribute to further processed the DCD-1L C-terminal to produce other derived-peptides [2].
Structural highlights
|
Dermcidin is an anionic channel composed of 6 DCD peptides organized in 3 antiparallel peptide dimers and has a dimension of about 8x4 nm. [3]. A DCD peptide has a secondary structure of a single α-helix.
Monomer
A monomer is a dimer formed by 2 elongated α-helix tied with 2 zinc ions. These Zn2+ ions are linked by N and C-terminal residues from each α-helix. Residues involved are charged amino acids such as . That is why, N-terminal is cationic whereas the C-terminal is anionic.
Assembly of three monomers
The trimer is formed by between 3 subunits. These bonds based on the zipper structure are managed again by the negatively (in blue) and positively (in red) charged residues so hydrophilic residues. (in pink) amino acids can be localized in the bond area too neglecting positive amino acids. In total, 96 residues are ionizable and which are all facing toward the interior of the tunnel forming : I,II,III,II,I as they are alterning negative (in blue) and positive (in red) charge. [4]. They create a channel overall charge of -12 because DCD-1L peptide is -2.
The amino acids pointing toward the exterior are (in grey) because they are able to interact with the acyl chain of the membrane. They play a role in the cell membrane insertion. [5]
The bonds between monomers allow the formation of 6 of a diameter of 1 nm (in purple). And the presence of polar residues may have an impact on the selection of ion entry.
The zinc cofactors
The zinc ions are found in sweat particularly enriched in divalent ions. Their presence is fundamental as if there are not here, dermcidin is no longer a channel. And the high permeability and conductance of the channel is allowed by Zn2+.
Antimicrobial activity
They may be effective because the sweat is acidic and composed of salt concentration such as sodium, chloride, potassium and magnesium.This form is involved in the innate immune system and protect from a variety of pathogenic microorganisms. N-ter interact with negatively charges from phospholipid of bacteria membrane ??
derived peptides described before modulate immune response (against particular micro-organism)
Related disease
atomic dermatitis ...
This is a sample scene created with SAT to by Group, and another to make of the protein. You can make your own scenes on SAT starting from scratch or loading and editing one of these sample scenes.
</StructureSection>
References
- ↑ Birgit Schittek, Rainer Hipfel, Birgit Sauer, Jürgen Bauer, Hubert Kalbacher, Stefan Stevanovic, Markus Schirle, Kristina Schroeder, Nikolaus Blin, Friedegund Meier, Gernot Rassner & Claus Garbe. "Dermcidin: a novel human antibiotic peptide secreted by sweat glands" Nature Immunology 2, no. 12 (December, 2001): 1133-37. https://www.nature.com/articles/ni732
- ↑ Daniel Baechle, Thomas Flad, Alexander Cansier, Heiko Steffen, Birgit Schittek, Jonathan Tolson, Timo Herrmann, Hassan Dihazi, Alexander Beck, Gerhard A. Mueller, Margret Mueller, Stefan Stevanovic, Claus Garbe, Claudia A. Mueller, and Hubert Kalbacher. "Cathepsin D Is Present in Human Eccrine Sweat and Involved in the Postsecretory Processing of the Antimicrobial Peptide DCD-1L" J. Biol. Chem. 281, no. 9 (March 3, 2006): 5406-15. http://www.jbc.org/content/281/9/5406.long
- ↑ Song, C. et al. "Crystal Structure and Functional Mechanism of a Human Antimicrobial Membrane Channel." PNAS 110, no. 12 (March 19, 2013): 4586-591. https://www.pnas.org/content/110/12/4586
- ↑ Song, C. et al. "Crystal Structure and Functional Mechanism of a Human Antimicrobial Membrane Channel." PNAS 110, no. 12 (March 19, 2013): 4586-591. https://www.pnas.org/content/110/12/4586
- ↑ Van Sang Nguyen, Kang Wei Tan, Karthik Ramesh, Fook Tim Chew & Yu Keung Mok. "Structural basis for the bacterial membrane insertion of dermcidin" Nature Scientific reports 7 : 13923 (2017). https://doi.org/10.1038/s41598-017-13600-z
1. Song, C. et al. : Crystal Structure and Functional Mechanism of a Human Antimicrobial Membrane Channel. PNAS. 2013 2. Maren Paulmann, Thomas Arnold, Dirk Linke, Suat Özdirekcan, Annika Kopp, Thomas Gutsmann, Hubert Kalbacher, Ines Wanke, Verena J. Schuenemann, Michael Habeck, Jochen Bürck, Anne S. Ulrich and Birgit Schittek :Structure-Activity Analysis of the Dermcidin-derived Peptide DCD-1L, an Anionic Antimicrobial Peptide Present in Human Sweat 3. Birgit Schittek, Rainer Hipfel, Birgit Sauer, Jürgen Bauer, Hubert Kalbacher, Stefan Stevanovic, Markus Schirle, Kristina Schroeder, Nikolaus Blin, Friedegund Meier, Gernot Rassner & Claus Garbe : Dermcidin: a novel human antibiotic peptide secreted by sweat glands 4. H. Steffen, S. Rieg, I. Wiedemann, H. Kalbacher, M. Deeg, H.-G. Sahl, A. Peschel, F. Götz, C. Garbe, B. Schittek : Naturally Processed Dermcidin-Derived Peptides Do Not Permeabilize Bacterial Membranes and Kill Microorganisms Irrespective of Their Charge. 5. Zhang, J., Ding, W., Kuai, X., Ji, Y., Zhu, Z., Mao, Z., Wang, Z. : Dermcidin as a novel binding protein of lncRNA STCAT3 and its effect on prognosis in gastric cancer. 2018
