2jr8

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 1: Line 1:
-
[[Image:2jr8.jpg|left|200px]]
+
{{Seed}}
 +
[[Image:2jr8.png|left|200px]]
<!--
<!--
Line 9: Line 10:
{{STRUCTURE_2jr8| PDB=2jr8 | SCENE= }}
{{STRUCTURE_2jr8| PDB=2jr8 | SCENE= }}
-
'''Solution structure of Manduca sexta moricin'''
+
===Solution structure of Manduca sexta moricin===
-
==Overview==
+
<!--
-
In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional (1)H--(1)H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. Copyright (c) 2008 European Peptide Society and John Wiley &amp; Sons, Ltd.
+
The line below this paragraph, {{ABSTRACT_PUBMED_18265434}}, adds the Publication Abstract to the page
 +
(as it appears on PubMed at http://www.pubmed.gov), where 18265434 is the PubMed ID number.
 +
-->
 +
{{ABSTRACT_PUBMED_18265434}}
==About this Structure==
==About this Structure==
-
2JR8 is a [[Single protein]] structure. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2JR8 OCA].
+
2JR8 is a [[Single protein]] structure. Full experimental information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2JR8 OCA].
==Reference==
==Reference==
Line 29: Line 33:
[[Category: Antimicrobial peptide]]
[[Category: Antimicrobial peptide]]
[[Category: Antimicrobial protein]]
[[Category: Antimicrobial protein]]
-
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Sun May 4 09:12:48 2008''
+
 
 +
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Wed Jul 9 10:06:02 2008''

Revision as of 07:06, 9 July 2008

Image:2jr8.png

Template:STRUCTURE 2jr8

Solution structure of Manduca sexta moricin

Template:ABSTRACT PUBMED 18265434

About this Structure

2JR8 is a Single protein structure. Full experimental information is available from OCA.

Reference

Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin., Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H, J Pept Sci. 2008 Feb 11;. PMID:18265434

Page seeded by OCA on Wed Jul 9 10:06:02 2008

Proteopedia Page Contributors and Editors (what is this?)

OCA

Retrieved from "http://52.214.119.220/wiki/index.php/2jr8"
Personal tools