This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


User:Eric Martz/Sandbox 6

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
(Overview - x)
(Overview - x)
Line 1: Line 1:
==Overview==
==Overview==
-
No empirical (X-ray crystallographic) 3D structure for the ''E. coli'' DnaC protein is available in December, 2008. In view of this, a homology model was constructed using the automated Swiss-Model server<ref name="methods">The model was created by Swiss-Model using its totally automated ''first approach'' mode.</ref><ref name="swissmodel">Arnold K., Bordoli L., Kopp J., and Schwede T. (2006). The SWISS-MODEL Workspace: A web-based environment for protein structure homology modelling. Bioinformatics, 22,195-201. [http://bioinformatics.oxfordjournals.org/cgi/content/abstract/22/2/195 Free full text]. Server: [http://swissmodel.expasy.org swissmodel.expasy.org]</ref>. Swiss-Model deemed the only usable template<ref name="3ec2_notemplate">Swiss-Model deemed the sequence alignment of ''E. coli'' DnaC with ''A. aeolicus'' DnaC to be too unreliable to permit using the [[3ec2]] structure of the latter as a template for homology modeling of <i>E. coli</i> DnaC.</ref> for the homology model to be the crystal structure of a "putative primosome component" from ''Streptococcus pyogenes'' ([[2qgz]]) determined by the Northeast Structural Genomics Consortium, "to be published". The main features of the tertiary structure of this homology model are confirmed by the structural similarity of a crystal structure (also "to be published") of the DnaC helicase loader of ''Aquafex aeolicus'' ([[3ec2]])<ref name="3ec2_notemplate" />. Therefore, the fold and topology of this model are likely to be correct. However, because the sequence identity between the template and the target <i>E. coli</i> DnaC is only 19%, there may be significant errors in the registration of the <i>E. coli</i> DnaC sequence with the structure. Further, the positions of sidechains in homology models are generally unreliable.
+
No empirical (X-ray crystallographic) 3D structure for the ''E. coli'' DnaC protein is available in December, 2008. In view of this, a homology model was constructed using the automated Swiss-Model server<ref name="methods">The model was created by Swiss-Model using its totally automated ''first approach'' mode.</ref><ref name="swissmodel">Arnold K., Bordoli L., Kopp J., and Schwede T. (2006). The SWISS-MODEL Workspace: A web-based environment for protein structure homology modelling. Bioinformatics, 22,195-201. [http://bioinformatics.oxfordjournals.org/cgi/content/abstract/22/2/195 Free full text]. Server: [http://swissmodel.expasy.org swissmodel.expasy.org]</ref>. Swiss-Model deemed the only usable template<ref name="3ec2_notemplate">Swiss-Model deemed the sequence alignment of ''E. coli'' DnaC with ''A. aeolicus'' DnaC to be too unreliable to permit using the [[3ec2]] structure of the latter as a template for homology modeling of <i>E. coli</i> DnaC.</ref> for the homology model to be the crystal structure of a "putative primosome component" from ''Streptococcus pyogenes'' ([[2qgz]]) determined by the Northeast Structural Genomics Consortium, "to be published". The main features of the tertiary structure of this homology model are confirmed by the structural similarity of a crystal structure (also "to be published") of the DnaC helicase loader of ''[http://microbewiki.kenyon.edu/index.php/Aquifex_aeolicus Aquafex aeolicus]'' ([[3ec2]])<ref name="3ec2_notemplate" />. Therefore, the fold and topology of this model are likely to be correct. However, because the sequence identity between the template and the target <i>E. coli</i> DnaC is only 19%, there may be significant errors in the registration of the <i>E. coli</i> DnaC sequence with the structure. Further, the positions of sidechains in homology models are generally unreliable.
 +
 
 +
The homology model represents 75% of the full length ''E. coli'' DnaC sequence, omitting 54 N-terminal residues, and 8 C-terminal residues.
We thank the authors of [[2qgz]] and [[3ec2]] for releasing their structure data at the [[Protein Data Bank]] prior to full publication. Without these data, the homology model of ''E. coli'' DnaC would not have been posssible in December, 2008.
We thank the authors of [[2qgz]] and [[3ec2]] for releasing their structure data at the [[Protein Data Bank]] prior to full publication. Without these data, the homology model of ''E. coli'' DnaC would not have been posssible in December, 2008.

Revision as of 02:43, 24 December 2008

Contents

Overview

No empirical (X-ray crystallographic) 3D structure for the E. coli DnaC protein is available in December, 2008. In view of this, a homology model was constructed using the automated Swiss-Model server[1][2]. Swiss-Model deemed the only usable template[3] for the homology model to be the crystal structure of a "putative primosome component" from Streptococcus pyogenes (2qgz) determined by the Northeast Structural Genomics Consortium, "to be published". The main features of the tertiary structure of this homology model are confirmed by the structural similarity of a crystal structure (also "to be published") of the DnaC helicase loader of Aquafex aeolicus (3ec2)[3]. Therefore, the fold and topology of this model are likely to be correct. However, because the sequence identity between the template and the target E. coli DnaC is only 19%, there may be significant errors in the registration of the E. coli DnaC sequence with the structure. Further, the positions of sidechains in homology models are generally unreliable.

The homology model represents 75% of the full length E. coli DnaC sequence, omitting 54 N-terminal residues, and 8 C-terminal residues.

We thank the authors of 2qgz and 3ec2 for releasing their structure data at the Protein Data Bank prior to full publication. Without these data, the homology model of E. coli DnaC would not have been posssible in December, 2008.

Homology Modeling

Templates for Homology Modeling of E. coli DnaC (245 amino acids)
Name PDB Code (Resolution) Released Length (amino acids)a Template alignment lengtha: range (%) Target alignment lengtha: range (%) Aligned Sequence Identity Expectations Swiss Model Result
Putative Primosome Component Streptococcus Pyogenes 2qgz (2.4 Å) Jul 24 2007 183 (308) 174:107-292 (95%) [sm] (183): 55-237 (75%) [sm] 18.6% [sm]; 19.7% [tdb] 3.4e-28 [sm]; 0.00027 [tdb]; >10 [pdbB]; 0.0028 [pdbF] DnaC modeled from 2qgz chain A
DnaC helicase loader Aquifex aeolicus 3ec2 (2.7 Å) Nov 25 2008 175 (180) 174: 6-179 (95%) [pdbB] (163): 68-230 (67%) [pdbB] 23.5% [pdbB] 0.00059 [pdbB] "Alignment is not good enough for Modelling"

Sources: Swiss-Model [sm]; targetdb.pdb.org [tdb]; pdb.org using a BLAST search [pdbB], or a FASTA search [pdbF].
(a) Lengths not in parentheses are for crystallographic results, and are counts of amino acids with coordinates; they exclude "gaps" of disordered residues. Lengths in parentheses are for the target sequence of DnaC, or sequences of the crystallized protein (from SEQRES in the PDB file).

Structural alignment of 2QGZ with 3EC2

DeepView 3.6b3 magic fit: 2qgz 115-259 aligned with 3ec2 42-185 (3 gaps: 128-9, 134-5, 155-9). 135 alpha carbons were aligned with RMS 2.76 Å.

Inspection of the alignment suggests that the chains could be aligned in these ranges:

2qgz (116 - 294, length xxx without gaps; 179 including missing residues.

3ec2 (42-221, length 177 without gap of 3; 180 including missing residues 188-190)
127=MSE.

Homology Model of DnaC

Drag the structure with the mouse to rotate

The following sequence was provided for DnaC from E. coli:

MKNVGDLMQR LQKMMPAHIK PAFKTGEELL AWQKEQGAIR SAALERENRA
MKMQRTFNRS GIRPLHQNCS FENYRVECEG QMNALSKARQ YVEEFDGNIA
SFIFSGKPGT GKNHLAAAIC NELLLRGKSV LIITVADIMS AMKDTFRNSG
TSEEQLLNDL SNVDLLVIDE IGVQTESKYE KVIINQIVDR RSSSKRPTGM
LTNSNMEEMT KLLGERVMDR MRLGNSLWVI FNWDSYR
SRV TGKEY

This sequence (245 amino acids) was submitted to Swiss Model, which generated the homology model shown here () using 2qgz chain A as a template, which has 18.6% sequence identity. Apparently Swiss Model used predicted secondary structure to help in the sequence alignment, but details are not clear to me. The homology model represents residues 55-237 (183 residues representing 75% of dnaC), shown in boldface in the above sequence. Because of the low sequence identity, this model may well contain major errors, or even be wholly incorrect.

Swiss Model has apparently used the temperature value field in the PDB file to indicate regions that are highly unreliable, namely the regions that are red when the model is . These regions are shown as translucent white in the initial scene (using the Jmol command select temperature >50). The uncertainty in three of these regions is explained by gaps in the template model (see below). Although the details of these regions are even more uncertain than other regions, it seems likely that these loops are on the surface, if the homology model turns out to be substantially correct.

Evolutionary Conservation in the Homology Model

The evolutionary conservation pattern, revealed by ConSurf, is quite interesting, showing .[4]

Homology Model in FirstGlance

In order to find specific residues, or see charge distribution or other aspects of this homology model, please View The DnaC Homology Model in FirstGlance in Jmol

Structural Alignment with Closest Hit at PDB

Residues 9-63 structurally aligned with the homology model of dnaC.

Drag the structure with the mouse to rotate

When the PDB is searched with the dnaC sequence, the closest hit is 39% identity with residues 9-63 of chain A of replication factor C (2CHG), which align with 72-124 of dnaC. When the above homology model of dnaC (made with template 2QGZ) is structurally aligned with residues 9-63 of 2CHG[5], 43 alpha carbons (out of 54) aligned with RMS deviation 2.3 Å. Residues 21-63 of 2CHG aligned with residues 80-124 of the dnaC homology model. (Non-aligned portions are pastel.) This result adds some confidence to the homology model, since the structural alignment of 2CHG:A21-63 occurred in the same range as the sequence alignment (which was 72-124 in dnaC).

Crystal Structure of DnaC Is "In The Pipeline"

A sequence-based search at the international Structural Genomics TargetDB reveals that the closest completed structure is 2QGZ, the one chosen by SwissModel as a template. A number of crystal and NMR structures have sequence identities up to 37% but over shorter stretches, and with higher E values.

Diffraction data have been obtained (but the solved structure not yet deposited) for a Listeria monocytogenes sequence of 307 residues, pI 5.2, with an E value of 1.6e-05, though only 21% sequence identity. Diffraction-quality crystals (but not yet diffraction data) have not been obtained for any sequence with such a low E value.

E. coli dnaC (245 residues, pI 9.4) has been crystallized by RIKEN Structural Genomics Initiative (Japan), but the crystals may not be of diffraction quality. It has been cloned, expressed as a soluble protein, and purified (but not yet crystallized) by 3 Structural Genomics Groups (RIKEN Structural Genomics Initiative (Japan), Montreal-Kingston Bacterial Structural Genomics Initiative, Midwest Center for Structural Genomics), as have several proteins with >40% sequence identity. So there is reason for optimism that either a crystal structure, or a more suitable template for homology modeling, will be forthcoming soon. One might consider contacting the groups who have reported purification of dnaC to inquire about progress, and possibly request priority for dnaC.

Gaps in the Template Model

Drag the structure with the mouse to rotate

The template was 2QGZ (). The portion of the template used was Glu107-Arg300. Only the amino-terminal 6 residues were not used as template (translucent). Note that there are in this segment of the template that lack coordinates due to disorder in the crystal (marked with spacefilled alpha-carbon atoms).

The missing loops are 202-205 (NGSV), 226-231 (EQATSW), and 268-275 (TIKGSDET). These gaps, which occur between the residues marked /\ below, were apparently ignored in making the model, which has a continuous main chain.

Below is the alignment produced by Swiss Model, used in making the 3D model. Vertical bars for identity were inserted by hand (I may have missed some).

                                                 |     | |  |     ||
TARGET    55             R TFNRSGIRPL HQNCSFENYR VECEGQMNAL SKARQYVEEF
2qgzA     100   qkqaais--e riqlvslpks yrhihlsdid vnnasrmeaf saildfveqy
                                                                      
TARGET                     sssss    h h             hhhhhhh hhhhhhhhh 
2qgzA               hhh  h   sss    h h             hhhhhhh hhhhhhhhh 

                            |         | ||   ||     | |              |
TARGET    96    DGN-IASFIF SGKPGTGKNH LAAAICNELL L-RGKSVLII TVADIMSAMK
2qgzA     148   psaeqkglyl ygdmgigksy llaamahels ekkgvsttll hfpsfaidvk
                                                                      
TARGET                ssss ss     hhh hhhhhhhhhh h h   ssss sshhhhhhh 
2qgzA                 ssss ss     hhh hhhhhhhhhh hh    ssss sshhhhhhh 

                                   ||   |  | ||                |
TARGET    144   DTFRNSGTSE EQLLNDLSNV DLLVIDEIGV QTESKYEKVI INQIVDRRSS
2qgzA     198   naiske---- --eidavknv pvlilddiga vrde-----v lqvilqyrml
                   /\                          / \
TARGET                         hhh     ssssss               hhhhhhhhhh
2qgzA                        hh   h    ssssss               hhhhhhhhhh

                   |     |                 ||| |  |               |
TARGET    194   SKRPTGMLTN SNMEEMTKLL ---GERVMDR MRLGNSLWVI FNWDSYR   
2qgzA     247   eelptfftsn ysfadlerkw awqakrvmer vr-ylarefh leganrr-  
                                      /\
TARGET          h  ssssss    hhhhh          hhhh hh  ssssss s         
2qgzA           h  ssssss    hhhh           hhhh hh hh ssss s 

Below is the sequence with ATOM records (coordinates) from 2QGZ, numbered 100-300, showing the gaps as "...". This sequence listing was used to locate the positions marked /\ above.

    1 .......... .......... .......... .......... .......... 
   51 .......... .......... .......... .......... .........Q 
  101 KQAAISERIQ LVSLPKSYRH IHLSDIDVNN ASRMEAFSAI LDFVEQYPSA 
  151 EQKGLYLYGD MGIGKSYLLA AMAHELSEKK GVSTTLLHFP SFAIDVKNAI 
  201 S....KEEID AVKNVPVLIL DDIGA..... .VRDEVLQVI LQYRMLEELP 

  251 TFFTSNYSFA DLERKWA... .....WQAKR VMERVRYLAR EFHLEGANRR 

(Copied from Protein Explorer's sequence display.)

Below is the alignment of full-length dnaC with 2QGZ according to TargetDB (see above). Note that the 2QGZ structure begins at residue 100, and so the homology model begins with residue 55 of dnaC, indicated with > below.

ID:   DR58   Center: NESGC
E-value: 0.00028  Identity: 19.737%

                                     10        20        30        
Query                        MKNVGDLMQRLQKMMPAHIKPAFKTGEELLAWQKEQGA
                                     Q+ Q   P++I  +++    +     + + 
Subjct EVASFISQHHLSQEQINLSLSKFNQFLVERQKYQLKDPSYIAKGYQPILAMNEGYADVSY
               40        50        60        70        80        90

       40        50    >   60        70        80        90        
Query  IRSAALERENRAMKMQRTFNRSGIRPLHQNCSFENYRVECEGQMNALSKARQYVEEF-DG
       +++  L + ++   +++ ++  ++   +++  + +  V+  ++M+A+S   ++VE++ ++
Subjct LETKELVEAQKQAAISERIQLVSLPKSYRHIHLSDIDVNNASRMEAFSAILDFVEQYPSA
              100       110       120       130       140       150

       100       110       120        130       140       150      
Query  NIASFIFSGKPGTGKNHLAAAICNELLLR-GKSVLIITVADIMSAMKDTFRNSGTSEEQL
       +  ++ + G  G GK++L AA+ +EL  + G S+ ++   ++   +K+++ N++++EE  
Subjct EQKGLYLYGDMGIGKSYLLAAMAHELSEKKGVSTTLLHFPSFAIDVKNAISNGSVKEE--
              160       170       180       190       200          

        160       170        180       190       200       210     
Query  LNDLSNVDLLVIDEIGV-QTESKYEKVIINQIVDRRSSSKRPTGMLTNSNMEEMTK----
       ++ ++NV +L++D+IG+ Q+ S  +  +++ I++ R   + PT + +N ++ ++ +    
Subjct IDAVKNVPVLILDDIGAEQATSWVRDEVLQVILQYRMLEELPTFFTSNYSFADLERKWAT
      210       220       230       240       250       260        

                    220       230       240     
Query  LLG-------ERVMDRMRLGNSLWVIFNWDSYRSRVTGKEY
       + G       +RVM+R+R                       
Subjct IKGSDETWQAKRVMERVRYLAREFHLEGANRR         
      270       280       290       300         

Notes

  1. The model was created by Swiss-Model using its totally automated first approach mode.
  2. Arnold K., Bordoli L., Kopp J., and Schwede T. (2006). The SWISS-MODEL Workspace: A web-based environment for protein structure homology modelling. Bioinformatics, 22,195-201. Free full text. Server: swissmodel.expasy.org
  3. 3.0 3.1 Swiss-Model deemed the sequence alignment of E. coli DnaC with A. aeolicus DnaC to be too unreliable to permit using the 3ec2 structure of the latter as a template for homology modeling of E. coli DnaC.
  4. ConSurf found only 10 sequences in SwissProt, with an Average Pairwise Distance of 1.6. The run shown here used 100 sequences from Uniprot, with an APD of 1.4.
  5. Structural alignment done with DeepView 3.6b3 using Magic Fit of carbon alphas.

Proteopedia Page Contributors and Editors (what is this?)

Eric Martz

Personal tools