This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


Sandbox 30

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 6: Line 6:
(Specifically PDB: 1QLQ)
(Specifically PDB: 1QLQ)
<applet load='1QLQ' size='450' frame='true' align='right' caption='Click on the links to the left to view different structural aspects. Ligand shown: SO4' />
<applet load='1QLQ' size='450' frame='true' align='right' caption='Click on the links to the left to view different structural aspects. Ligand shown: SO4' />
-
==Structure Quick Links==
+
==Overview and Quick Links==
 +
Trypsin was first isolated by , Wilhelm Kühnein 1867Trypsin is a serine protease synthesized in the pancreas but is not activated until the zymogen form of trypsin is activated. This presents trypsin from digesting actual body tissue<ref> [http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6TGT-49S6WV8-1&_user=4187488&_coverDate=12/31/2003&_rdoc=1&_fmt=high&_orig=search&_origin=search&_sort=d&_docanchor=&view=c&_acct=C000062504&_version=1&_urlVersion=0&_userid=4187488&md5=a7d7e1b154a43b709d5228c4852e5d10&searchtype=a doi:10.1016/j.theochem.2003.08.072]</ref>.
An easy way to distinguish between main structural components of the protein is to view it using <scene name='Sandbox_30/Trypsin_cartoon_rainbow/2'>rainbow coloration.</scene> To see various other specific structures of Trypsin, click on their links.
An easy way to distinguish between main structural components of the protein is to view it using <scene name='Sandbox_30/Trypsin_cartoon_rainbow/2'>rainbow coloration.</scene> To see various other specific structures of Trypsin, click on their links.
* <scene name='Sandbox_30/Trypsin_cartoon_rainbow/2'>Rainbow Coloration</scene>
* <scene name='Sandbox_30/Trypsin_cartoon_rainbow/2'>Rainbow Coloration</scene>
Line 22: Line 23:
==Structure==
==Structure==
-
Trypsin's primary amino acid sequence (RPDFCLEPPYAGACRARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCLRTCGGA) <ref> 1qlq [http://bip.weizmann.ac.il/oca-bin/send-seq?1qlq_A]</ref> forms the <scene name='Sandbox_30/Backbone/1'>backbone</scene> of the protein, which then folds into secondary structures, consisting of two <scene name='Sandbox_30/Helixs_maroon/3'>α helices</scene> and two <scene name='Sandbox_30/Sheets_green/4'>β sheets</scene>. Both of the α helices are right handed and the β sheets are anti-parallel. The order of the secondary structures is easily visible when using the <scene name='Sandbox_30/Trypsin_cartoon_rainbow/2'>rainbow coloration</scene> scheme to identify secondary structures. The N-terminus (blue) is the beginning of trypsin and the C-terminus (agua-green) is the end.
+
Trypsin's primary amino acid sequence (RPDFCLEPPYAGACRARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCLRTCGGA) <ref>[http://bip.weizmann.ac.il/oca-bin/send-seq?1qlq_A 1qlq]</ref> forms the <scene name='Sandbox_30/Backbone/1'>backbone</scene> of the protein, which then folds into secondary structures, consisting of two <scene name='Sandbox_30/Helixs_maroon/3'>α helices</scene> and two <scene name='Sandbox_30/Sheets_green/4'>β sheets</scene>. Both of the α helices are right handed and the β sheets are anti-parallel. The order of the secondary structures is easily visible when using the <scene name='Sandbox_30/Trypsin_cartoon_rainbow/2'>rainbow coloration</scene> scheme to identify secondary structures. The N-terminus (blue) is the beginning of trypsin and the C-terminus (agua-green) is the end.

Revision as of 23:50, 29 October 2010

Please do NOT make changes to this Sandbox. Sandboxes 30-60 are reserved for use by Biochemistry 410 & 412 at Messiah College taught by Dr. Hannah Tims during Fall 2012 and Spring 2013.


Contents

Trypsin

(Specifically PDB: 1QLQ)

Click on the links to the left to view different structural aspects. Ligand shown: SO4

Drag the structure with the mouse to rotate

Overview and Quick Links

Trypsin was first isolated by , Wilhelm Kühnein 1867Trypsin is a serine protease synthesized in the pancreas but is not activated until the zymogen form of trypsin is activated. This presents trypsin from digesting actual body tissue[1]. An easy way to distinguish between main structural components of the protein is to view it using To see various other specific structures of Trypsin, click on their links.

  • - Ball and stick
  • - Space filling model


Structure

Trypsin's primary amino acid sequence (RPDFCLEPPYAGACRARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCLRTCGGA) [2] forms the of the protein, which then folds into secondary structures, consisting of two and two . Both of the α helices are right handed and the β sheets are anti-parallel. The order of the secondary structures is easily visible when using the scheme to identify secondary structures. The N-terminus (blue) is the beginning of trypsin and the C-terminus (agua-green) is the end.


Polar and Nonpolar Residues

Polar residues are typically hydrophobic, and seek to be sheltered from the aqueous environments that proteins typically inhibit. The polarity of an amino acid is determined by its (orange). When considering the it may look like the polar (blue) and nonpolar (crimson) residues are not organized in a specific manner, but when you consider the it is evident that the majority of the nonpolar residues are shielded by the polar residues. Another way to show this principle is by looking at the location of the of Trypsin (red). The hydrophobic portions desire to be shielded from the water in the smallest area possible in order to minimize its interaction with water, thereby maximizing the entropy of the water. It is evident that basically all water molecules are kept outside the protein when viewing a (water-blue, trypsin-orange). This form of trypsin (PDB 1QLQ), has been modified to help enable its crystalization, and thus has four water molecules inside of it instead of the normal three which is present in the wild-type trpsin[3].

Intramolecular and Intermolecular Forces

The structure of trypsin is stabilized by a variety of intramolecular and intermolecular forces. Trypsin has three which form between cysteine amino acids. Disulfide bonds are especially important for structural stability in extracellular environments, where conditions are more prone to fluctuation. Secondary structures are stabilized via interactions that compliment their specific side chains. For example, the first α helix in trypsin's structure is stabilized by several other in the molecule itself. The ball and stick amino acids marked with an * are part of α helix while the space filling molecules stabilize the α helix. the The α helix is also stabilized by as well as (water is dark blue).







Drag the structure with the mouse to rotate

References

  1. doi:10.1016/j.theochem.2003.08.072
  2. 1qlq
  3. Czapinska, Honorata et al. "High-resolution structure of bovine pancreatic trypsin inhibitor with altered binding loop sequence." Journal of Molecular Biology. Volume 295, Issue 5, 4 February 2000, Pages 1237-1249 doi:10.1006/jmbi.1999.3445
Personal tools