We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.

Sandbox chameleon

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 11: Line 11:
== Seeing is believing ==
== Seeing is believing ==
-
The IgG-Binding domain is displayed in Rainbow colors, ''i.e.'' going from Blue--->Red from N--->C terminal.
+
To simplify the figure, the entire IgG-Binding domain is colored <scene name='61/611439/Cartoon_beige/1'>beige</scene>.
-
To simplify things, the entire chain is colored <scene name='61/611439/Cartoon_beige/1'>beige</scene>.
+
-
Now displaying the mutated structure, where 5 amino acids, in the region <scene name='61/611439/Cartoon_pink_23-33/1'>23-33</scene>, are change to the ''Chameleon'' sequence, i.e. '''AWTVEKAFKTF'''
+
Now displaying, in pink, the amino acids in the region <scene name='61/611439/Cartoon_pink_23-33/1'>23-33</scene>, are change to the ''Chameleon'' sequence, i.e. '''AWTVEKAFKTF''' (only 5 amino acids are mutated).
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK<br />
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK<br />
Line 20: Line 19:
-
If a similar change from the Wild-Type to where 5 amino acids, in the region <scene name='61/611439/Cartoon_pink_42-52/1'>42-52</scene>
+
If a similar change from the Wild-Type to where 5 amino acids, in the region <scene name='61/611439/Cartoon_pink_42-52/1'>42-52</scene> are changed to the ''Chameleon'' sequence,
-
are changed to the ''Chameleon'' sequence,
+
specifically from/to:<br />
specifically from/to:<br />
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK<br />
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK<br />

Revision as of 16:39, 30 November 2014

Does the amino acid sequence really determine the 3D structure of a peptide?')

2gb1

Drag the structure with the mouse to rotate

References

  1. Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
  2. Zhou X, Alber F, Folkers G, Gonnet GH, Chelvanayagam G. An analysis of the helix-to-strand transition between peptides with identical sequence. Proteins. 2000 Nov 1;41(2):248-56. PMID:10966577
Personal tools