Chameleon peptide
From Proteopedia
(Difference between revisions)
Line 11: | Line 11: | ||
To simplify the figure, the entire IgG-Binding domain<ref>PMID:1871600 </ref> is colored <scene name='61/611445/Cartoon_beige/1'>beige</scene>. Now displaying, in pink, the amino acids in the region <scene name='61/611445/Cartoon_pink_23-33/1'>23-33</scene>, are change to the ''Chameleon'' sequence, i.e. <span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style> (only 5 amino acids are mutated), specifically from/to:<br /> | To simplify the figure, the entire IgG-Binding domain<ref>PMID:1871600 </ref> is colored <scene name='61/611445/Cartoon_beige/1'>beige</scene>. Now displaying, in pink, the amino acids in the region <scene name='61/611445/Cartoon_pink_23-33/1'>23-33</scene>, are change to the ''Chameleon'' sequence, i.e. <span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style> (only 5 amino acids are mutated), specifically from/to:<br /> | ||
- | <font face=Courier>TTYKLILNGKTLKGETTTEAVD<span style="color:#000000; background:#FFFF00">AATAEKVFKQY</span style>ANDNGVDGEWTYDDATKTFTVTEK<br /> | + | <font face=Courier> |
+ | TTYKLILNGKTLKGETTTEAVD<span style="color:#000000; background:#FFFF00">AATAEKVFKQY</span style>ANDNGVDGEWTYDDATKTFTVTEK<br /> | ||
TTYKLILNGKTLKGETTTEAVD<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>ANDNGVDGEWTYDDATKTFTVTEK</font face> | TTYKLILNGKTLKGETTTEAVD<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>ANDNGVDGEWTYDDATKTFTVTEK</font face> | ||
If a similar change from the Wild-Type to where 5 amino acids, in the region <scene name='61/611445/Cartoon_pink_42-52/1'>42-52</scene> are changed to the ''Chameleon'' sequence, specifically from/to:<br /> | If a similar change from the Wild-Type to where 5 amino acids, in the region <scene name='61/611445/Cartoon_pink_42-52/1'>42-52</scene> are changed to the ''Chameleon'' sequence, specifically from/to:<br /> | ||
- | <font face=Courier>TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#000000; background:#FFFF00">EWTYDDATKTF</span style>TVTEK<br /> | + | <font face=Courier> |
- | + | TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#000000; background:#FFFF00">EWTYDDATKTF</span style>TVTEK<br /> | |
+ | TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>TVTEK</font face> | ||
== 3D structure of sequence adopts to environment == | == 3D structure of sequence adopts to environment == |
Revision as of 17:24, 1 December 2014
Does the amino acid sequence really determine the 3D structure of a peptide?')
|
References
- ↑ Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
- ↑ Zhou X, Alber F, Folkers G, Gonnet GH, Chelvanayagam G. An analysis of the helix-to-strand transition between peptides with identical sequence. Proteins. 2000 Nov 1;41(2):248-56. PMID:10966577
- ↑ Gronenborn AM, Filpula DR, Essig NZ, Achari A, Whitlow M, Wingfield PT, Clore GM. A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein G. Science. 1991 Aug 9;253(5020):657-61. PMID:1871600