Chameleon peptide

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 16: Line 16:
Mutated: TTYKLILNGKTLKGETTTEAVD<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>ANDNGVDGEWTYDDATKTFTVTEK</font face>
Mutated: TTYKLILNGKTLKGETTTEAVD<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>ANDNGVDGEWTYDDATKTFTVTEK</font face>
-
If a similar change from the Wild-Type to where 5 amino acids, in the region <scene name='61/611445/Cartoon_pink_42-52/1'>42-52</scene> are changed to the ''Chameleon'' sequence, specifically from/to:<br />
+
If a similar change in the WT sequences is made to the Chameleon sequence for residues <scene name='61/611445/Cartoon_pink_42-52/1'>42-52</scene> again virtually no change in the 3D structure of this protein is seen.<br />
<font face=Courier>
<font face=Courier>
-
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#000000; background:#FFFF00">EWTYDDATKTF</span style>TVTEK<br />
+
WT: &emsp;&emsp;&emsp;&emsp; TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#000000; background:#FFFF00">EWTYDDATKTF</span style>TVTEK<br />
-
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>TVTEK</font face>
+
Mutated: TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDG<span style="color:#FFFFFF; background:#FF69B4">AWTVEKAFKTF</span style>TVTEK</font face>
== 3D structure of sequence adopts to environment ==
== 3D structure of sequence adopts to environment ==

Revision as of 17:43, 1 December 2014

Does the amino acid sequence really determine the 3D structure of a peptide?')

2gb1

Drag the structure with the mouse to rotate

References

  1. Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
  2. Zhou X, Alber F, Folkers G, Gonnet GH, Chelvanayagam G. An analysis of the helix-to-strand transition between peptides with identical sequence. Proteins. 2000 Nov 1;41(2):248-56. PMID:10966577
  3. Gronenborn AM, Filpula DR, Essig NZ, Achari A, Whitlow M, Wingfield PT, Clore GM. A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein G. Science. 1991 Aug 9;253(5020):657-61. PMID:1871600

Proteopedia Page Contributors and Editors (what is this?)

Joel L. Sussman, Michal Harel

Personal tools