This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


Sandbox Reserved 996

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
(Starting Structure Section)
Line 4: Line 4:
Ectatomin (1eci) is the main component of venom of the ant [https://en.wikipedia.org/wiki/Ectatomma_tuberculatum Ectatomma tuberculatum]. When bitten by E. tuberculatum, Ectatomin inserts into the target's [https://en.wikipedia.org/wiki/Cell_membrane cell membranes] and forms a nonselective [https://en.wikipedia.org/wiki/Ion_channel cation channel].
Ectatomin (1eci) is the main component of venom of the ant [https://en.wikipedia.org/wiki/Ectatomma_tuberculatum Ectatomma tuberculatum]. When bitten by E. tuberculatum, Ectatomin inserts into the target's [https://en.wikipedia.org/wiki/Cell_membrane cell membranes] and forms a nonselective [https://en.wikipedia.org/wiki/Ion_channel cation channel].
-
<scene name='69/691538/Cysteine_disulfide/1'>Disulfide</scene>
 
== Structure ==
== Structure ==
-
Biologically, Ectatomin exists as a heterodimer. Each subunit is composed of two α-helices, linked by disulfide bonds, with a connecting hairpin hinge region. The two subunits are linked by a disfulide bond between their hairpin hinge regions.
+
Biologically, Ectatomin exists as a heterodimer stabilized by <scene name='69/691538/Cysteine_disulfide/1'>disulfide</scene> linkages. The α subunit has 37 amino acid residues, while the β subunit has 34 amino acid residues. The structure of Ectatomin was solved using 2D NMR and CHARMm computational optimization, though there are 20 similar proposed conformations.
 +
 
 +
Generally, each subunit is composed of two α-helices, linked by disulfide bonds, with a connecting hairpin hinge region. The two subunits are linked by a disfulide bond between their hairpin hinge regions. One α-helix from each subunit is kinked, due to the presence of proline residues. The kinked α-helix of the α subunit is more kinked, containing three proline residues, while the kinked α-helix of the β subunit only contains one proline residue.
 +
 
 +
The internal region between the two subunits is primarily composed of hydrophobic residues.
 +
 
 +
Sequence - α subunit
 +
GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL
 +
 
 +
Sequence - β subunit
 +
WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK
== Mechanism ==
== Mechanism ==

Revision as of 22:53, 25 February 2015

Template:Ectatomin 1eci

Ectatomin (1eci)

Drag the structure with the mouse to rotate

References

Personal tools