This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


2jr8

From Proteopedia

(Difference between revisions)
Jump to: navigation, search

OCA (Talk | contribs)
(New page: 200px {{Structure |PDB= 2jr8 |SIZE=350|CAPTION= <scene name='initialview01'>2jr8</scene> |SITE= |LIGAND= |ACTIVITY= |GENE= |DOMAIN=<span class='plainlinks'>[h...)
Next diff →

Revision as of 07:51, 26 March 2008


PDB ID 2jr8

Drag the structure with the mouse to rotate
Domains: Moricin
Resources: FirstGlance, OCA, PDBsum, JenaLib, RCSB
Coordinates: save as pdb, mmCIF, xml



Solution structure of Manduca sexta moricin


Overview

In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional (1)H--(1)H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. Copyright (c) 2008 European Peptide Society and John Wiley & Sons, Ltd.

About this Structure

2JR8 is a Single protein structure of sequence from [1]. Full crystallographic information is available from OCA.

Reference

Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin., Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H, J Pept Sci. 2008 Feb 11;. PMID:18265434

Page seeded by OCA on Wed Mar 26 09:51:24 2008

Proteopedia Page Contributors and Editors (what is this?)

OCA

Personal tools