2jr8
From Proteopedia
(New page: 200px {{Structure |PDB= 2jr8 |SIZE=350|CAPTION= <scene name='initialview01'>2jr8</scene> |SITE= |LIGAND= |ACTIVITY= |GENE= |DOMAIN=<span class='plainlinks'>[h...) |
|||
| Line 8: | Line 8: | ||
|GENE= | |GENE= | ||
|DOMAIN=<span class='plainlinks'>[http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=pfam06451 Moricin]</span> | |DOMAIN=<span class='plainlinks'>[http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=pfam06451 Moricin]</span> | ||
| - | |RESOURCES=<span class='plainlinks'>[http://oca.weizmann.ac.il/oca-docs/fgij/fg.htm?mol=2jr8 FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=2jr8 OCA], [http://www.ebi.ac.uk/pdbsum/2jr8 PDBsum | + | |RELATEDENTRY= |
| + | |RESOURCES=<span class='plainlinks'>[http://oca.weizmann.ac.il/oca-docs/fgij/fg.htm?mol=2jr8 FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=2jr8 OCA], [http://www.ebi.ac.uk/pdbsum/2jr8 PDBsum], [http://www.rcsb.org/pdb/explore.do?structureId=2jr8 RCSB]</span> | ||
}} | }} | ||
| Line 32: | Line 33: | ||
[[Category: antimicrobial protein]] | [[Category: antimicrobial protein]] | ||
| - | ''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on | + | ''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Mon Mar 31 04:01:03 2008'' |
Revision as of 01:01, 31 March 2008
| |||||||
| Domains: | Moricin | ||||||
| Resources: | FirstGlance, OCA, PDBsum, RCSB | ||||||
| Coordinates: | save as pdb, mmCIF, xml | ||||||
Solution structure of Manduca sexta moricin
Overview
In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional (1)H--(1)H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. Copyright (c) 2008 European Peptide Society and John Wiley & Sons, Ltd.
About this Structure
2JR8 is a Single protein structure of sequence from [1]. Full crystallographic information is available from OCA.
Reference
Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin., Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H, J Pept Sci. 2008 Feb 11;. PMID:18265434
Page seeded by OCA on Mon Mar 31 04:01:03 2008
