This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


1ryv

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 1: Line 1:
[[Image:1ryv.jpg|left|200px]]
[[Image:1ryv.jpg|left|200px]]
-
{{Structure
+
<!--
-
|PDB= 1ryv |SIZE=350|CAPTION= <scene name='initialview01'>1ryv</scene>
+
The line below this paragraph, containing "STRUCTURE_1ryv", creates the "Structure Box" on the page.
-
|SITE=
+
You may change the PDB parameter (which sets the PDB file loaded into the applet)
-
|LIGAND= <scene name='pdbligand=NH2:AMINO+GROUP'>NH2</scene>
+
or the SCENE parameter (which sets the initial scene displayed when the page is loaded),
-
|ACTIVITY=
+
or leave the SCENE parameter empty for the default display.
-
|GENE=
+
-->
-
|DOMAIN=
+
{{STRUCTURE_1ryv| PDB=1ryv | SCENE= }}
-
|RELATEDENTRY=[[1niy|1NIY]], [[1ryg|1RYG]]
+
-
|RESOURCES=<span class='plainlinks'>[http://oca.weizmann.ac.il/oca-docs/fgij/fg.htm?mol=1ryv FirstGlance], [http://oca.weizmann.ac.il/oca-bin/ocaids?id=1ryv OCA], [http://www.ebi.ac.uk/pdbsum/1ryv PDBsum], [http://www.rcsb.org/pdb/explore.do?structureId=1ryv RCSB]</span>
+
-
}}
+
'''Three dimensional solution structure of the K27A MUTANT of sodium channels inhibitor HAINANTOXIN-IV BY 2D 1H-NMR'''
'''Three dimensional solution structure of the K27A MUTANT of sodium channels inhibitor HAINANTOXIN-IV BY 2D 1H-NMR'''
Line 19: Line 16:
==About this Structure==
==About this Structure==
-
1RYV is a [[Single protein]] structure of sequence from [http://en.wikipedia.org/wiki/ ]. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=1RYV OCA].
+
1RYV is a [[Single protein]] structure. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=1RYV OCA].
==Reference==
==Reference==
Line 28: Line 25:
[[Category: Liang, S.]]
[[Category: Liang, S.]]
[[Category: Lu, S.]]
[[Category: Lu, S.]]
-
[[Category: inhibitor cystine knot motif]]
+
[[Category: Inhibitor cystine knot motif]]
-
[[Category: neurotoxin]]
+
[[Category: Neurotoxin]]
-
 
+
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Sat May 3 08:04:53 2008''
-
''Page seeded by [http://oca.weizmann.ac.il/oca OCA ] on Sun Mar 30 23:34:55 2008''
+

Revision as of 05:04, 3 May 2008

Template:STRUCTURE 1ryv

Three dimensional solution structure of the K27A MUTANT of sodium channels inhibitor HAINANTOXIN-IV BY 2D 1H-NMR


Overview

Hainantoxin-IV (HNTX-IV) can specifically inhibit the neuronal tetrodotoxin-sensitive sodium channels and defines a new class of depressant spider toxin. The sequence of native HNTX-IV is ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH(2). In the present study, to obtain further insight into the primary and tertiary structural requirements of neuronal sodium channel blockers, we determined the solution structure of HNTX-IV as a typical inhibitor cystine knot motif and synthesized four mutants designed based on the predicted sites followed by structural elucidation of two inactive mutants. Pharmacological studies indicated that the S12A and R26A mutants had activities near that of native HNTX-IV, while K27A and R29A demonstrated activities reduced by 2 orders of magnitude. (1)H MR analysis showed the similar molecular conformations for native HNTX-IV and four synthetic mutants. Furthermore, in the determined structures of K27A and R29A, the side chains of residues 27 and 29 were located in the identical spatial position to those of native HNTX-IV. These results suggested that residues Ser(12), Arg(26), Lys(27), and Arg(29) were not responsible for stabilizing the distinct conformation of HNTX-IV, but Lys(27) and Arg(29) were critical for the bioactivities. The potency reductions produced by Ala substitutions were primarily due to the direct interaction of the essential residues Lys(27) and Arg(29) with sodium channels rather than to a conformational change. After comparison of these structures and activities with correlated toxins, we hypothesized that residues Lys(27), Arg(29), His(28), Lys(32), Phe(5), and Trp(30) clustered on one face of HNTX-IV were responsible for ligand binding.

About this Structure

1RYV is a Single protein structure. Full crystallographic information is available from OCA.

Reference

Structure--activity relationships of hainantoxin-IV and structure determination of active and inactive sodium channel blockers., Li D, Xiao Y, Xu X, Xiong X, Lu S, Liu Z, Zhu Q, Wang M, Gu X, Liang S, J Biol Chem. 2004 Sep 3;279(36):37734-40. Epub 2004 Jun 16. PMID:15201273 Page seeded by OCA on Sat May 3 08:04:53 2008

Proteopedia Page Contributors and Editors (what is this?)

OCA

Personal tools