General question: To determine the extent to which non-local factors influence the formation of secondary structural elements
Methodology: Design the longest possible sequence that can fold into an alpha-helix when inserted into one place in a protein sequence and a beta-sheet when inserted into another
You may include any references to papers as in: the use of JSmol in Proteopedia or to the article describing Jmol [1] to the rescue.
Function
Display this IgG-Binding domain in
i.e. going from Blue---Red from N--->C terminal. To simplify things entire chain is colored .
Displaying the structure mutated structure, where 5 amino acids, in this region , are change to the Chameleon sequence, i.e. AWTVEKAFKTF
i.e. going from:
TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK
TTYKLILNGKTLKGETTTEAVDAWTVEKAFKTFANDNGVDGEWTYDDATKTFTVTEK
If a similar change from the Wild-Type to 5 amino acids, in the region
