Sandbox chameleon

From Proteopedia

Revision as of 16:05, 30 November 2014 by Joel L. Sussman (Talk | contribs)
Jump to: navigation, search

Your Heading Here (maybe something like 'Structure')

2gb1

Drag the structure with the mouse to rotate
are changed to the Chameleon sequence,

i.e. going from:

TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK TTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGAWTVEKAFKTFTVTEK


</StructureSection>

References

  1. Minor DL Jr, Kim PS. Context-dependent secondary structure formation of a designed protein sequence. Nature. 1996 Apr 25;380(6576):730-4. PMID:8614471 doi:http://dx.doi.org/10.1038/380730a0
  2. Herraez A. Biomolecules in the computer: Jmol to the rescue. Biochem Mol Biol Educ. 2006 Jul;34(4):255-61. doi: 10.1002/bmb.2006.494034042644. PMID:21638687 doi:10.1002/bmb.2006.494034042644
Personal tools