This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


Human growth hormone

From Proteopedia

Revision as of 08:05, 27 March 2016 by Michal Harel (Talk | contribs)
Jump to: navigation, search


Template:STRUCTURE 1hgu

Human growth hormone (hGH) plays a vital role in growth and development. It is naturally produced by somatotropic cells in the anterior pituitary gland. The hormone is produced as a 217 amino acid precursor protein. The 26 N-terminal amino acids correspond to a signal peptide, which is essential for hormone secretion. This signal peptide is cleaved during the secretion process to yield the mature, 191 amino acid form of hGH.

Mature hGH travels through the bloodstream and interacts with a specific hGH-receptor on the surface of various cells, including muscle, bone, and cartilage. Binding of hGH to its receptor causes dimerization and signal transduction, which ultimately stimulates cellular division. HGH also indirectly influences growth by stimulating the liver to produce additional growth factors, such as insulin-like growth factor-1. Synthetic versions of hGH produced by recombinant DNA technology are used to treat growth disorders associated with hGH deficiencies.

Contents

Location in the Body

hGH is produced in the anterior pituitary gland and is circulated throughout the body. hGH interacts with a variety of cells while in the bloodstream including muscle and bone cells. It eventually reaches and stimulates growth of all major organs (particularly the liver where it stimulates the production of growth factors) with the exception of the brain.

Growth Hormone’s Signal Peptide

Human growth hormone exists in two forms, pre-GH and mature GH. The pre-protein contains a 26 residue-long signal peptide located on the N-terminus of the protein, which is cleaved off to create the mature protein.

The signal peptide acts as an anchor to keep the pre-protein bound to the membrane of the endoplasmic reticulum (ER). Following proper signaling, an ER membrane-bound signal I peptidase cleaves the 217 amino acid long pre-protein between residues 26 and 27 resulting in the 191 residue-long mature secretory GH (Chawla 1983; Tuteja 2005)[1]. The now active protein releases from the membrane into the ER lumen and is exported out of the cell.

Mutations to residues within the signal peptide have show to affect the secretion of GH from the cell. Specifically, the Lys16Pro variant is associated with decreased levels of GH due to suppressed secretion, resulting in growth hormone deficiency isolated type 1B (IGHD1B) (Millar D.S. 2003)[2].

Isoforms

There are four natural splice variants, or isoforms, of human growth hormone that have been identified. The different isoforms are produced when splicing of the five exons occurs at various positions. Note that in all four isoforms, the first 26 amino acids on the N-terminus are only present in the precursor form, and are not part of the active hormone. Isoform 1 is the most prominently found variant and is deemed as the canonical sequence, meaning that it serves as the reference to the other isoforms in terms of location of features. One of the key differences about the other isoforms is that since they are lacking certain sections of amino acids, then the single point mutations that naturally occur in those regions will not affect the function or activity of the isoform proteins. For example, there several single point mutations that occur in the range of amino acids 58 through 72 that result in reduced ability to activate the JAK/STAT pathway (Millar et al., 2003). This section is absent in isoform 2, and therefore that variant of the protein is not susceptible to such alterations. Similarly, there are single point mutations in the range of amino acids 111 through 148 and 117 through 162 that result in reduced secretion (Millar et al., 2003), reduced ability to activate the JAK/STAT pathway (Millar et al., 2003), and loss of activity (Takahashi et al., 1997)[3]. Therefore, since isoforms 2 and 3 are lacking these regions, they are not subject to these various effects on activity.

Isoform 1 (191 amino acids; MW = 24,847 kDa)

MATGSRTSLL LAFGLLCLPW LQEGSAFPTI PLSRLFDNAM LRAHRLHQLA FDTYQEFEEAYIPKEQKYSF LQNPQTSLCF SESIPTPSNR EETQQKSNLE LLRISLLLIQ SWLEPVQFLR SVFANSLVYG ASDSNVYDLL KDLEEGIQTL MGRLEDGSPR TGQIFKQTYS KFDTNSHNDDALLKNYGLLY CFRKDMDKVE TFLRIVQCRS VEGSCGF

Isoform 2 (176 amino acids; MW = 22,992 kDa; Missing amino acids 58-72)

MATGSRTSLL LAFGLLCLPW LQEGSAFPTI PLSRLFDNAM LRAHRLHQLA FDTYQEFNPQTSLCFSESIP TPSNREETQQ KSNLELLRIS LLLIQSWLEP VQFLRSVFAN SLVYGASDSNVYDLLKDLEE GIQTLMGRLE DGSPRTGQIF KQTYSKFDTN SHNDDALLKN YGLLYCFRKDMDKVETFLRI VQCRSVEGSC GF

Isoform 3 (153 amino acids; MW = 20,561 kDa; Missing amino acids 111-148)

MATGSRTSLL LAFGLLCLPW LQEGSAFPTI PLSRLFDNAM LRAHRLHQLA FDTYQEFEEAYIPKEQKYSF LQNPQTSLCF SESIPTPSNR EETQQKSNLE LLRISLLLIQ TLMGRLEDGSPRTGQIFKQT YSKFDTNSHN DDALLKNYGL LYCFRKDMDK VETFLRIVQC RSVEGSCGF

Isoform 4 (145 amino acids; MW = 19,802 kDa; Missing amino acids 117-162)

MATGSRTSLL LAFGLLCLPW LQEGSAFPTI PLSRLFDNAM LRAHRLHQLA FDTYQEFEEAYIPKEQKYSF LQNPQTSLCF SESIPTPSNR EETQQKSNLE LLRISLLLIQ SWLEPVQIFKQTYSKFDTNS HNDDALLKNY GLLYCFRKDM DKVETFLRIV QCRSVEGSCG F


Structure

Primary Sequence

hGH is produced within the cell as a pre-protein, consisting of a 191 polypeptide chain associated with a 26 amino acid signal peptide. This signal peptide functions in membrane translocation, and is eventually cleaved to yield the mature form of hGH-1. The signal peptide is cleaved from the 191 polypeptide chain of hGH-1 by an ER membrane-bound protease (Chawla, Parks, and Rudman, 1983)

MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEF EAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFR SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSH NDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Primary Sequence of hGH-1 precursor

Primary Sequence Variations between Isoforms: hGH-1 (most abundant isoform): has a primary amino acid sequence of 191 amino acids Isoform 2: amino acid residues 58-72 of hGH-1 are excluded Isoform 3: excludes amino acid residues 111-148 Isoform 4: excludes amino acid residues 117-162

Secondary Structure

hGH is a single chain peptide, which was 45% helical with 8 α-helices (Chantalat et al., 1995)[4]. Protein Data Bank (PDB) provides predicted secondary structures of different proteins using the research from the paper and an algorithm program.

Tertiary Structure

The known crystal structure of hGH illustrate that the core of the protein is a four-helix bundle. Helices 1 & 4 at the NH2 and COOH ends are longer than helices 2 & 3 (Abraham 1992). A short loop connects helices 2 & 3 and two long crossover connections link helices 1 & 2 and helices 3 & 4. The helices run up-up-down-down (Abraham 1992). This is unusually because normally four helix bundles exhibit up-down-up-down orientation.

An additional three much smaller helices exist within the connecting loops: one at beginning of the connection between helices 1& 2, one at the end of the connection between helices 1 & 2, and one in the short loop connection between helices 2 & 3 (Abraham 1992).

Post-translational modifications

Phosphorylation
HGH is phosphorylated on Ser residues 132 and 176 (Giorgianni, Beranova-Giorgianni, and Desiderio, 2004)[5]. Other research has indicated possible phosphorylation of Tyr residues 35 and 42. However, these phosphorylations were only investigated in carcinoma cells with constitutively active epidermal growth factor-stimulated tyrosine kinase (Baldwin et al., 1983)[6]. The overall influence of these post-translational modifications on hGH activity has yet to be determined.

Metal Binding Sites
Histidine 18 /* May be best just to add scene link featuring these. The coordinates listed in the previous version don't really say much. */ Histidine 21 /* May be best just to add scene link featuring these. The coordinates listed in the previous version don't really say much. */ Glutamine 174 /* May be best just to add scene link featuring these. The coordinates listed in the previous version don't really say much. */

Receptor Binding Site

The Receptor binds to Residues 54 and 74 of hGH Residue 54 is a Phenylalanine. /* May be best just to add scene link featuring these. The coordinates listed in the previous version don't really say much. */ Residue 74 is a Glutamine. /* May be best just to add scene link featuring these. The coordinates listed in the previous version don't really say much. */

Secretion Mechanism

It was previously believed that after stimulating HGH secretion, membrane bound secretory vesicles containing the hormone dock at the cell plasma membrane. These vesicles were believed to become completely incorporated into the plasma membrane, and would later be retrieved via endocytosis, thus allowing for passive release of the HGH within the vesicles. However, this mechanism is not supported by experimental evidence, such as the appearance of empty and partially empty vesicles immediately after secretion. Bhanu Jena’s laboratory has recently elucidated the molecular mechanism of cellular secretion. Their studies suggest that there is actually a new cellular structure called a porosome that is involved with the mechanism. Porosomes are “basket-like” structures residing at the plasma membrane that have a 100-150nm diameter opening to the extracellular environment (Figure 1). Rather than docking directly at the plasma membrane post secretion stimulation, membrane bound secretory vesicles fuse at the base of porosomes, which subsequently expel the vesicular contents (Figure 2). During stimulation, the opening dilates about 20-35% to aid in the expulsion of HGH. The porosome returns to the resting size once the process is complete (Anderson et al., 2004)[7].

There exist several hypothalamic hormones that control growth hormone release. The most major of these secretion stimuli is the growth hormone release factor (GHRH). In contrast, the hormone known as somatostatin (SRIF) is known to suppress the release of GH by the somatotrope. These two hormones are the most well known, though it should be noted that there are multiple other control factors which both stimulate and suppress the release of HGH into the bloodstream (Anderson et al., 2004).

Mechanism of Action

In order to facilitate this behavior as a hormone somatotropin binds to two receptors on the outside of a cell known as Human Growth Hormone Binding Proteins (hGHpb). Once the Human Growth hormone binds both receptors (first one, then the second), it causes a shift in the receptor protein, which in turn causes an internal signaling cascade. This cascade is how somatotropin is able to effect cell growth and function. In addition it can cause the release of other growth factors, like Insulin Growth Factor.


Inhibitors

Somatostatin

The body’s primary mechanism of regulating hGH is to release somatostatin, also known as growth hormone inhibitory hormone (GHIH). Somatostatin is produced in the hypothalamus and released by the anterior pituitary gland, pancreas, and GI tract (Somatostatin, 2011). This hormone works together with growth hormone releasing hormone (GHRH) to properly regulate the secretion of hGH from the pituitary gland. Somatostatin levels are directly affected by levels of circulating hGH. Specifically, levels of somatostatin are high when hGH concentrations are high, and low when hGH is low.

There are two forms of somatostatin found in the body. One form, known as SS-14, is 14 amino acids long and found primarily in the nervous system and pancreas. The other has an amino acid chain length of 28 and is called SS-28. This form is found predominantly in the GI tract. SS-28 is a much stronger inhibitor of hGH then SS-14 (Bowen, 2002). Most of the body’s receptors don’t differentiate between the two forms of somatostatin. All receptors are G protein-coupled receptors and inhibit adenyl cyclase, which, in turn, affects a number of hormones and second messengers (Bowen, 2002).

Glucocorticoids

Glucocorticoids are a type of steroid hormones that regulate hGH levels two different ways. Studies have shown that glucocorticoids are able to suppress the release of GHRH as well as reduce GHRH receptor responsiveness (Miller et al., 1997)[8]. Due to the suppression of GHRH, the levels of hGH in the body eventually subside. There is also data to suggest that glucocorticoids work with somatostatin release in the hypothalamus (Lima et al., 1993)[9]. Besides interactions with GHRH and somatostatin, glucocorticoids can affect adrenergic receptors (both alpha 2-adrenergic and beta-adrenergic receptors, which are stimulated by catecholamines in the sympathetic nervous system. When stimulated, the alpha receptors have shown to stimulate hGH release, whereas stimulation of beta receptors can inhibit hGH release (Blackard, 1968).

Hyperglycemia and Insulin

Times of high sugar levels in the body are generally accompanied with higher insulin levels. In this state, insulin and related hormones like Insulin-like Growth Factor (IGF-1) have been shown to decrease binding affinity between hGH and its receptors (Shaonin et al., 1997). With lower levels of insulin and IGF-1, hGH secretion and levels can quickly and continuously rise. Although insulin and IGF-1 don't directly act on hGH receptors, they can affect the signaling cascade pathway that hGH uses (Yakar et al., 2004)[10]. JAK2 is one of the proteins found in this signaling pathway and has been known to be affected during hGH/insulin feedback and regulation loops (Shaonin et al., 1997).

Associated Diseases and Treatments

Diseases associated with human growth hormone are related to deficiency or overproduction of the hormone.

Deficiency in somatostatin can occur in childhood or adulthood. Congenital deficiency is typically associated with an abnormal pituitary gland but can also be part of a larger syndrome or condition1. Acquired deficiency can develop from multiple sources including infection, brain tumors, injury, brain surgery or radiation to the head1. There are cases in which no direct cause can be identified. Pituitary tumors which have been treated with surgery or radiation are the typically cause of GH deficiency in adults.

Symptoms of deficiency in children include short stature, slow growth, late onset of puberty, increased fat around the waist, and delayed tooth development1. Pituitary dwarfism can result from untreated deficiency in children. In adults the symptoms include low energy, decreased strength and muscle mass, low stamina, weight gain (especially around the waist), anxiety, depression and thin, dry skin1. Deficiency can also cause increased total cholesterol, LDL (low density lipoprotein), apolipoprotein B, and triglyceride levels and can reduce bone density.

The general treatment for dwarfism is HgH injections. The sooner this treatment is started, the more effective it will be in overcoming the deleterious effects of deficient HgH. These injections are applied anywhere from several times a week to once a day. Further care for people afflicted with HgH deficient dwarfism involves psychological therapy to help deal with the social ramifications of such a short stature (A.D.A.M. Growth hormone).

Injection of GH has been implicated in the development of Creutzfeldt-Jakob Disease. This association has only been found in GH isolated from cadavers. Originally isolation of the protein from cadavers was the method of development for replacement therapies. Now recombinant methods of production are the main method for synthesis. There seems to be no association in recombinant DNA-produced GH and Creutzfeldt-Jakob disease2.

Diseases can also result from levels of GH being too high. The effects of excess GH vary based on age. Gigantism is excess of GH during childhood and Acromegaly is excess of GH during adulthood (after bone growth has stopped). Symptoms of gigantism include delayed puberty, double vision, headache, increased sweating, large hands and feet, and weakness3. Symptoms of acromegaly vary slightly and include body odor, carpal tunnel syndrome, fatigue, weakness, increased sweating, joint pain, large hands and feet, sleep apnea, thickening of skin, widely spaced teeth, and unintentional weight loss4.

Excess GH release most often occurs because of a pituitary gland tumor3. It can also be due to Carney complex, McCune-Albright syndrome, multiple endocrine neoplasia type 1, and neurofibromatosis3. Treatment includes medications to decrease hormone release and, in severe cases, removal of the pituitary gland.

Acromegaly, or gigantism, is most commonly treated with surgery. Removing the tumor in the pituitary gland can stop the excess release of growth hormone. This is completely successful in approximately 60 percent of cases. Incomplete success is often attributed to the size of the tumor; large tumors cannot always be completely removed, resulting in continued high levels of hormone release (Freda, 2002)[11]. Surgery is often supplemented, or in some cases replaced, by radiation therapy. Radiation of the pituitary can help reduce levels of hormone release by killing tumor cells, but reduction of release as a result of radiation is a slow process and is not as successful as surgery. For this reason, it is more commonly used in tandem with surgery, rather than alone (Freda, 2002; A.D.A.M. Acromegaly).

Certain medications can also be used in some combination with surgery and radiation. There are two classifications of acromegaly medication treatments. The first reduces HgH release from the pituitary. Somatostatin agonists reduce HgH release in approximately 50 percent of patients. They act by binding to somatostatin receptors, which regulate hormone control. The seemingly low level of success is due to certain tumors being resistant to somatostatin agonists. There are currently two somatostatin agonists on the market. Octreotide is a long acting release medication that needs to be injected about once a month. Lanreotide is a slow release medication that needs to be administered by injection about every other week. The second class of medication is an analog of HgH that competitively binds to HgH receptors, without activating them. Pegvisomant is an HgH analog that blocks the binding of HgH to HgH inhibitors. It is injected daily (Freda, 2002; A.D.A.M. Acromegaly).

3D structures of human growth hormone

Updated on 27-March-2016

1huw, 1hgu – HGH – human
3hhr, 1hwg, 1kf9 – HGH + HGH receptor
1hwh, 1a22 – HGH (mutant) + HGH receptor
1axi – HGH (mutant) + HGH receptor (mutant)
1bp3 – HGH (mutant) + prolactin receptor

References

  1. Chawla RK, Parks JS, Rudman D. Structural variants of human growth hormone: biochemical, genetic, and clinical aspects. Annu Rev Med. 1983;34:519-47. PMID:6344776 doi:http://dx.doi.org/10.1146/annurev.me.34.020183.002511
  2. Millar DS, Lewis MD, Horan M, Newsway V, Easter TE, Gregory JW, Fryklund L, Norin M, Crowne EC, Davies SJ, Edwards P, Kirk J, Waldron K, Smith PJ, Phillips JA 3rd, Scanlon MF, Krawczak M, Cooper DN, Procter AM. Novel mutations of the growth hormone 1 (GH1) gene disclosed by modulation of the clinical selection criteria for individuals with short stature. Hum Mutat. 2003 Apr;21(4):424-40. PMID:12655557 doi:http://dx.doi.org/10.1002/humu.10168
  3. Takahashi Y, Shirono H, Arisaka O, Takahashi K, Yagi T, Koga J, Kaji H, Okimura Y, Abe H, Tanaka T, Chihara K. Biologically inactive growth hormone caused by an amino acid substitution. J Clin Invest. 1997 Sep 1;100(5):1159-65. PMID:9276733 doi:10.1172/JCI119627
  4. Michel G, Chantalat L, Duee E, Barbeyron T, Henrissat B, Kloareg B, Dideberg O. The kappa-carrageenase of P. carrageenovora features a tunnel-shaped active site: a novel insight in the evolution of Clan-B glycoside hydrolases. Structure. 2001 Jun;9(6):513-25. PMID:11435116
  5. Giorgianni F, Beranova-Giorgianni S, Desiderio DM. Identification and characterization of phosphorylated proteins in the human pituitary. Proteomics. 2004 Mar;4(3):587-98. PMID:14997482 doi:http://dx.doi.org/10.1002/pmic.200300584
  6. Baldwin GS, Knesel J, Monckton JM. Phosphorylation of gastrin-17 by epidermal growth factor-stimulated tyrosine kinase. Nature. 1983 Feb 3;301(5899):435-7. PMID:6600511
  7. Andersen O, Haugaard SB, Flyvbjerg A, Andersen UB, Orskov H, Madsbad S, Nielsen JO, Iversen J. Low-dose growth hormone and human immunodeficiency virus-associated lipodystrophy syndrome: a pilot study. Eur J Clin Invest. 2004 Aug;34(8):561-8. PMID:15305891 doi:http://dx.doi.org/10.1111/j.1365-2362.2004.01380.x
  8. Miller TL, Mayo KE. Glucocorticoids regulate pituitary growth hormone-releasing hormone receptor messenger ribonucleic acid expression. Endocrinology. 1997 Jun;138(6):2458-65. PMID:9165036 doi:http://dx.doi.org/10.1210/endo.138.6.5184
  9. Lima L, Arce V, Diaz MJ, Tresguerres JA, Devesa J. Glucocorticoids may inhibit growth hormone release by enhancing beta-adrenergic responsiveness in hypothalamic somatostatin neurons. J Clin Endocrinol Metab. 1993 Feb;76(2):439-44. PMID:8094392 doi:http://dx.doi.org/10.1210/jcem.76.2.8094392
  10. Yakar S, Setser J, Zhao H, Stannard B, Haluzik M, Glatt V, Bouxsein ML, Kopchick JJ, LeRoith D. Inhibition of growth hormone action improves insulin sensitivity in liver IGF-1-deficient mice. J Clin Invest. 2004 Jan;113(1):96-105. PMID:14702113 doi:http://dx.doi.org/10.1172/JCI17763
  11. Freda PU, Post KD, Powell JS, Wardlaw SL. Evaluation of disease status with sensitive measures of growth hormone secretion in 60 postoperative patients with acromegaly. J Clin Endocrinol Metab. 1998 Nov;83(11):3808-16. PMID:9814451 doi:http://dx.doi.org/10.1210/jcem.83.11.5266

See Also

Personal tools