User:Bhaskar Ganguly/MyBo HyPo

From Proteopedia

Jump to: navigation, search

The MyBo HyPo Database


Welcome to the Mycobacterium bovis' Hypothetical Protein (MyBo HyPo) Project.

The MyBo HyPo Project aims a computational characterization of all hypothetical proteins (HPs) of M. bovis. As for now, computationally-derived models of 14 M. bovis HP UniRefs, obtained at a 90% sequence identity cut-off from the UniProt Database, are being included. These models shall be updated as and when models of better quality become available. We also plan to add models for other sequences over the coming periods of time. - Bhaskar Ganguly, Ph.D.; Sunil Kr. Rastogi, Ph.D.


Contents

M. bovis HP A0A083W064

Drag the structure with the mouse to rotate

Sequence

MARQPLEQRVARAAQAALARQRFVSAIDVLLGLGWLAPSHVDQWRQGRVDSLEQVVQANL SKITAVMAALRRWARDRGLNPSETDYVARTRDRRRLRFSVTGEDAIERAYRTHWVSPELS ERAVARQSRRPDLVVIMPVNDWSCASCGGSGDLMFLEDAGPLCLDCADLGHLVFLPSGDA ALTRRAKRASRLSAVVVRWSRARKRYERQGILVEAEALERAENECLADAEVRARRRERDE ARRANEDLRLQAEFGAAIRTLFPNCPAGRAEAIARHAATRGSGRIGRSAAGRALDPEAVR LAVAASVRHIDTSFDELLMSGVDRETARHRVGEHVEEVLRDWRATSR

Length

347

Localization

Cytoplasmic

Putative Function

Arginine decarboxylase

Disease

Relevance

Structural highlights

References

Proteopedia Page Contributors and Editors (what is this?)

Bhaskar Ganguly

Personal tools