This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.
Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.
Search results
From Proteopedia
You searched for Ganguly,_A.K
There is no page with the exact title "Ganguly,_A.K". The search results for "Ganguly,_A.K" are displayed below. You can create a page titled Ganguly,_A.K (by clicking on the red link).
For more information about searching Proteopedia, see Help.
To exclude pages titled with 4-character PDB codes, use the checkbox "only Human created pages" at the bottom of this page.
Showing below up to 20 results starting with #1.
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
Article title matches
- Category:Koustav Ganguly (46 bytes)
1: List of pages with the keyword Koustav Ganguly - Category:Ganguly, A K (43 bytes)
1: List of pages with the keyword Ganguly, A K - Category:Ganguly, S (41 bytes)
1: List of pages with the keyword Ganguly, S - Category:Ganguly, M (41 bytes)
1: List of pages with the keyword Ganguly, M - Category:Ganguly, A (41 bytes)
1: List of pages with the keyword Ganguly, A - User:Bhaskar Ganguly (404 bytes)
1: * Bhaskar Ganguly, Ph.D.
7: * Pantnagar, Uttarakhand, India. PIN: 263145.
9: *[[User:Bhaskar Ganguly/Sandbox 1]]
11: *[[User:Bhaskar Ganguly/MyBo_HyPo]] - User:Bhaskar Ganguly/Sandbox 1 (810 bytes)
7: - ''Bhaskar Ganguly'', Ph.D.; ''Sunil Kr. Rastogi'', Ph.D.
12: ...M. bovis'' HP A0A083VPS0' scene='72/728006/Mybo_hp_a0a083vps0/1' /> - User:Bhaskar Ganguly/MyBo HyPo (12,175 bytes)
6: ...athogen has a potential for unraveling hitherto unknown drug and vaccine targets. ''M. bovis'' is an ...
9: - ''Bhaskar Ganguly'', Ph.D.; ''Sunil Kr. Rastogi'', Ph.D.
12: ...nload it and for access to more options. Left click and drag a model to rotate view.)
25: SKITAVMAALRRWARDRGLNPSETDYVARTRDRRRLRFSVTGEDAIERAYRT...
29: ALTRRAKRASRLSAVVVRWSRARKRYERQGILVEAEALERAENECLADAEVRARRRERDE - Category:Ganguly AK (41 bytes)
1: List of pages with the keyword Ganguly AK - Category:Ganguly A (40 bytes)
1: List of pages with the keyword Ganguly A - Category:Ganguly M (40 bytes)
1: List of pages with the keyword Ganguly M - Category:Ganguly S (40 bytes)
1: List of pages with the keyword Ganguly S - Category:Ganguly, S.S (43 bytes)
1: List of pages with the keyword Ganguly, S.S
Page text matches
- 1ib1 (4,440 bytes)
5: ...o sapiens] and [https://en.wikipedia.org/wiki/Ovis_aries Ovis aries]. Full crystallographic informatio...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=COT:COA...
8: ...e.do?structureId=1ib1 RCSB], [https://www.ebi.ac.uk/pdbsum/1ib1 PDBsum], [https://prosat.h-its.org/pr...
13: [[Image:Consurf_key_small.gif|200px|right]] - 1o5m (5,307 bytes)
5: ...re with sequence from [https://en.wikipedia.org/wiki/Rattus_norvegicus Rattus norvegicus]. Full cryst...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=336:4-{...
8: ...e.do?structureId=1o5m RCSB], [https://www.ebi.ac.uk/pdbsum/1o5m PDBsum], [https://prosat.h-its.org/pr...
11: ...uromuscular junction development downstream of MUSK (By similarity). - 2a4g (14,846 bytes)
2: ...=Hepatitis C Protease NS3-4A serine protease with Ketoamide Inhibitor SCH225724 Bound==
5: ..._C Hepacivirus C] and [https://en.wikipedia.org/wiki/Hepatitis_C_virus_subtype_1b Hepatitis C virus s...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=UNH:({1...
8: ...e.do?structureId=2a4g RCSB], [https://www.ebi.ac.uk/pdbsum/2a4g PDBsum], [https://prosat.h-its.org/pr... - 2qeg (3,821 bytes)
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=7GU:7-D...
8: ...e.do?structureId=2qeg RCSB], [https://www.ebi.ac.uk/pdbsum/2qeg PDBsum], [https://prosat.h-its.org/pr...
10: <div style="background-color:#fffaf0;">
12: ... C.G base pair, facilitating interstrand cross-linking. - 2qef (3,944 bytes)
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=7GU:7-D...
8: ...e.do?structureId=2qef RCSB], [https://www.ebi.ac.uk/pdbsum/2qef PDBsum], [https://prosat.h-its.org/pr...
10: <div style="background-color:#fffaf0;">
12: ... C.G base pair, facilitating interstrand cross-linking. - 2dyz (729 bytes)
7: ...g.htm?mol=2dyz FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dyz PDBsum], [https://prosat.h-its.org/pr...
13: [[Category: Koustav Ganguly]] - 2dz0 (729 bytes)
7: ...g.htm?mol=2dz0 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz0 PDBsum], [https://prosat.h-its.org/pr...
13: [[Category: Koustav Ganguly]] - 2dz1 (729 bytes)
7: ...g.htm?mol=2dz1 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz1 PDBsum], [https://prosat.h-its.org/pr...
13: [[Category: Koustav Ganguly]] - 2dz2 (729 bytes)
7: ...g.htm?mol=2dz2 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz2 PDBsum], [https://prosat.h-its.org/pr...
13: [[Category: Koustav Ganguly]] - 2dz3 (729 bytes)
7: ...g.htm?mol=2dz3 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz3 PDBsum], [https://prosat.h-its.org/pr...
13: [[Category: Koustav Ganguly]] - 2dz4 (739 bytes)
7: ...g.htm?mol=2dz4 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz4 PDBsum], [https://prosat.h-its.org/pr...
13: [[Category: Koustav Ganguly]] - 2dz5 (738 bytes)
7: ...g.htm?mol=2dz5 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz5 PDBsum], [https://prosat.h-its.org/pr...
13: [[Category: Koustav Ganguly]] - Category:Koustav Ganguly (46 bytes)
1: List of pages with the keyword Koustav Ganguly - 3oiy (3,582 bytes)
5: ...re with sequence from [https://en.wikipedia.org/wiki/Thermotoga_maritima Thermotoga maritima]. Full c...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=CL:CHLO...
8: ...e.do?structureId=3oiy RCSB], [https://www.ebi.ac.uk/pdbsum/3oiy PDBsum], [https://prosat.h-its.org/pr...
10: <div style="background-color:#fffaf0;"> - 3opi (4,072 bytes)
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=7DA:7-D...
8: ...e.do?structureId=3opi RCSB], [https://www.ebi.ac.uk/pdbsum/3opi PDBsum], [https://prosat.h-its.org/pr...
10: <div style="background-color:#fffaf0;">
12: ...m, which probably results from less favorable stacking interactions in the modified duplex, which was... - 2lia (4,017 bytes)
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">Solution NMR</td></tr>
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=2LA:2-A...
8: ...e.do?structureId=2lia RCSB], [https://www.ebi.ac.uk/pdbsum/2lia PDBsum], [https://prosat.h-its.org/pr...
10: <div style="background-color:#fffaf0;">
12: ...lso observed for the G3:C10 base pair, where alphaKop for the G3:C10 base pair in the modified duplex... - 4kav (4,232 bytes)
3: ...on load='4kav' size='340' side='right'caption='[[4kav]], [[Resolution|resolution]] 1.43Å' scene...
5: .../b> use [https://proteopedia.org/fgij/fg.htm?mol=4KAV FirstGlance]. <br>
6: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=CU:COPP...
7: ...ttps://prosat.h-its.org/prosat/prosatexe?pdbcode=4kav ProSAT]</span></td></tr>
11: <div style="background-color:#fffaf0;"> - 4kay (4,160 bytes)
3: ...on load='4kay' size='340' side='right'caption='[[4kay]], [[Resolution|resolution]] 1.78Å' scene...
5: .../b> use [https://proteopedia.org/fgij/fg.htm?mol=4KAY FirstGlance]. <br>
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=PO4:PHO...
8: ...ttps://prosat.h-its.org/prosat/prosatexe?pdbcode=4kay ProSAT]</span></td></tr> - 4lqg (4,434 bytes)
5: ...re with sequence from [https://en.wikipedia.org/wiki/Homo_sapiens Homo sapiens]. Full crystallographi...
6: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=BMA:BET...
7: ...e.do?structureId=4lqg RCSB], [https://www.ebi.ac.uk/pdbsum/4lqg PDBsum], [https://prosat.h-its.org/pr...
10: ... peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory ne...
11: <div style="background-color:#fffaf0;"> - 4mc1 (8,749 bytes)
5: ...re with sequence from [https://en.wikipedia.org/wiki/Human_immunodeficiency_virus_1 Human immunodefic...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=526:(3S...
8: ...e.do?structureId=4mc1 RCSB], [https://www.ebi.ac.uk/pdbsum/4mc1 PDBsum], [https://prosat.h-its.org/pr...
11: ...gated. Since this process occurs at both cuts flanking the HIV genome, a 5 bp duplication of host DNA...
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
You may also try
