Search results

From Proteopedia

proteopedia linkproteopedia link

There is no page with the exact title "Ganguly,_A.K.". The search results for "Ganguly,_A.K." are displayed below. You can create a page titled Ganguly,_A.K. (by clicking on the red link).

For more information about searching Proteopedia, see Help.

Showing below up to 20 results starting with #1.

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

Article title matches

1. Category:Ganguly, C (41 bytes)
   1: List of pages with the keyword Ganguly, C
2. Category:Koustav Ganguly (46 bytes)
   1: List of pages with the keyword Koustav Ganguly
3. Category:Ganguly SS (41 bytes)
   1: List of pages with the keyword Ganguly SS
4. Category:Ganguly, A K (43 bytes)
   1: List of pages with the keyword Ganguly, A K
5. Category:Ganguly, S (41 bytes)
   1: List of pages with the keyword Ganguly, S
6. Category:Ganguly, M (41 bytes)
   1: List of pages with the keyword Ganguly, M
7. Category:Ganguly, A (41 bytes)
   1: List of pages with the keyword Ganguly, A
8. User:Bhaskar Ganguly (404 bytes)
   1: * Bhaskar Ganguly, Ph.D.
   7: * Pantnagar, Uttarakhand, India. PIN: 263145.
   9: *[[User:Bhaskar Ganguly/Sandbox 1]]
   11: *[[User:Bhaskar Ganguly/MyBo_HyPo]]
9. User:Bhaskar Ganguly/Sandbox 1 (810 bytes)
   7: - ''Bhaskar Ganguly'', Ph.D.; ''Sunil Kr. Rastogi'', Ph.D.
   12: ...M. bovis'' HP A0A083VPS0' scene='72/728006/Mybo_hp_a0a083vps0/1' />
10. User:Bhaskar Ganguly/MyBo HyPo (12,175 bytes)
    6: ...athogen has a potential for unraveling hitherto unknown drug and vaccine targets. ''M. bovis'' is an ...
    9: - ''Bhaskar Ganguly'', Ph.D.; ''Sunil Kr. Rastogi'', Ph.D.
    12: ...nload it and for access to more options. Left click and drag a model to rotate view.)
    25: SKITAVMAALRRWARDRGLNPSETDYVARTRDRRRLRFSVTGEDAIERAYRT...
    29: ALTRRAKRASRLSAVVVRWSRARKRYERQGILVEAEALERAENECLADAEVRARRRERDE
11. Category:Ganguly AK (41 bytes)
    1: List of pages with the keyword Ganguly AK
12. Category:Ganguly A (40 bytes)
    1: List of pages with the keyword Ganguly A
13. Category:Ganguly M (40 bytes)
    1: List of pages with the keyword Ganguly M
14. Category:Ganguly S (40 bytes)
    1: List of pages with the keyword Ganguly S
15. Category:Ganguly, S.S (43 bytes)
    1: List of pages with the keyword Ganguly, S.S

Page text matches

1. 1ib1 (4,440 bytes)
   5: ...o sapiens] and [https://en.wikipedia.org/wiki/Ovis_aries Ovis aries]. Full crystallographic informatio...
   6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
   7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=COT:COA...
   8: ...e.do?structureId=1ib1 RCSB], [https://www.ebi.ac.uk/pdbsum/1ib1 PDBsum], [https://prosat.h-its.org/pr...
   13: [[Image:Consurf_key_small.gif|200px|right]]
2. 9umx (418 bytes)
   5: ...K., Ganguly, M., Mishra, S., Dalal, A., Shukla, A.K.
   9: [[Category: Ganguly, M]]
   10: [[Category: Yadav, M.K]]
   11: [[Category: Shukla, A.K]]
3. 9umj (483 bytes)
   5: ...y, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K.
   12: [[Category: Ganguly, M]]
   13: [[Category: Yadav, M.K]]
   14: [[Category: Shukla, A.K]]
4. 9umr (421 bytes)
   5: ...K., Ganguly, M., Mishra, S., Dalal, A., Shukla, A.K.
   10: [[Category: Shukla, A.K]]
   13: [[Category: Yadav, M.K]]
   14: [[Category: Ganguly, M]]
5. 1o5m (5,307 bytes)
   5: ...re with sequence from [https://en.wikipedia.org/wiki/Rattus_norvegicus Rattus norvegicus]. Full cryst...
   6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
   7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=336:4-{...
   8: ...e.do?structureId=1o5m RCSB], [https://www.ebi.ac.uk/pdbsum/1o5m PDBsum], [https://prosat.h-its.org/pr...
   11: ...uromuscular junction development downstream of MUSK (By similarity).
6. 9mkv (364 bytes)
   3: The entry 9mkv is ON HOLD until Paper Publication
   5: Authors: Ganguly, C., Thomas, L.M., Aribam, S.D., Martin, L., Raja...
   9: [[Category: Ganguly, C]]
7. Category:Ganguly, C (41 bytes)
   1: List of pages with the keyword Ganguly, C
8. 9mkx (365 bytes)
   3: The entry 9mkx is ON HOLD until Paper Publication
   5: Authors: Ganguly, C., Thomas, L.M., Aribam, S.D., Martin, L., Raja...
   11: [[Category: Ganguly, C]]
9. 2a4g (4,038 bytes)
   2: ...=Hepatitis C Protease NS3-4A serine protease with Ketoamide Inhibitor SCH225724 Bound==
   5: ...acivirus hominis] and [https://en.wikipedia.org/wiki/Hepatitis_C_virus_subtype_1b Hepatitis C virus s...
   6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
   7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=UNH:({1...
   8: ...e.do?structureId=2a4g RCSB], [https://www.ebi.ac.uk/pdbsum/2a4g PDBsum], [https://prosat.h-its.org/pr...
10. 2qeg (3,821 bytes)
    6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
    7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=7GU:7-D...
    8: ...e.do?structureId=2qeg RCSB], [https://www.ebi.ac.uk/pdbsum/2qeg PDBsum], [https://prosat.h-its.org/pr...
    10: <div style="background-color:#fffaf0;">
    12: ... C.G base pair, facilitating interstrand cross-linking.
11. 2qef (3,944 bytes)
    6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
    7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=7GU:7-D...
    8: ...e.do?structureId=2qef RCSB], [https://www.ebi.ac.uk/pdbsum/2qef PDBsum], [https://prosat.h-its.org/pr...
    10: <div style="background-color:#fffaf0;">
    12: ... C.G base pair, facilitating interstrand cross-linking.
12. 2dyz (729 bytes)
    7: ...g.htm?mol=2dyz FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dyz PDBsum], [https://prosat.h-its.org/pr...
    13: [[Category: Koustav Ganguly]]
13. 2dz0 (729 bytes)
    7: ...g.htm?mol=2dz0 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz0 PDBsum], [https://prosat.h-its.org/pr...
    13: [[Category: Koustav Ganguly]]
14. 2dz1 (729 bytes)
    7: ...g.htm?mol=2dz1 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz1 PDBsum], [https://prosat.h-its.org/pr...
    13: [[Category: Koustav Ganguly]]
15. 2dz2 (729 bytes)
    7: ...g.htm?mol=2dz2 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz2 PDBsum], [https://prosat.h-its.org/pr...
    13: [[Category: Koustav Ganguly]]
16. 2dz3 (729 bytes)
    7: ...g.htm?mol=2dz3 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz3 PDBsum], [https://prosat.h-its.org/pr...
    13: [[Category: Koustav Ganguly]]
17. 2dz4 (739 bytes)
    7: ...g.htm?mol=2dz4 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz4 PDBsum], [https://prosat.h-its.org/pr...
    13: [[Category: Koustav Ganguly]]
18. 2dz5 (738 bytes)
    7: ...g.htm?mol=2dz5 FirstGlance], [https://www.ebi.ac.uk/pdbsum/2dz5 PDBsum], [https://prosat.h-its.org/pr...
    13: [[Category: Koustav Ganguly]]
19. Category:Koustav Ganguly (46 bytes)
    1: List of pages with the keyword Koustav Ganguly
20. 3oiy (3,582 bytes)
    5: ...re with sequence from [https://en.wikipedia.org/wiki/Thermotoga_maritima Thermotoga maritima]. Full c...
    6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
    7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=CL:CHLO...
    8: ...e.do?structureId=3oiy RCSB], [https://www.ebi.ac.uk/pdbsum/3oiy PDBsum], [https://prosat.h-its.org/pr...
    10: <div style="background-color:#fffaf0;">

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

Search in namespaces:
(Main) Talk User User talk Proteopedia Proteopedia talk Image Image talk MediaWiki MediaWiki talk Template Template talk Help Help talk Category Category talk Journal Journal talk Tutorial Tutorial talk Group Group talk Studio Studio talk Book Book talk Mutation Mutation talk Art Art talk BASIL BASIL talk
List redirects
Search for