We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.
Search results
From Proteopedia
You searched for Hege,_D
There is no page with the exact title "Hege,_D". The search results for "Hege,_D" are displayed below. You can create a page titled Hege,_D (by clicking on the red link).
For more information about searching Proteopedia, see Help.
To exclude pages titled with 4-character PDB codes, use the checkbox "only Human created pages" at the bottom of this page.
Showing below 19 results starting with #1.
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
Article title matches
- Category:Hege, D (38 bytes)
1: List of pages with the keyword Hege, D - Category:Hege, T (38 bytes)
1: List of pages with the keyword Hege, T - Category:Hege T (37 bytes)
1: List of pages with the keyword Hege T - Category:Hege D (37 bytes)
1: List of pages with the keyword Hege D
Page text matches
- 1go7 (2,443 bytes)
11: [https://www.uniprot.org/uniprot/PRTC_DICCH PRTC_DICCH]
16: ...ptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; script "...
26: [[Category: Hege T]] - 1jiw (4,270 bytes)
16: ...ptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; script "...
26: ...itor: inhibition by a zinc-NH2 coordinative bond.,Hege T, Feltzer RE, Gray RD, Baumann U J Biol Chem. 20...
40: [[Category: Hege T]] - 1k7g (4,621 bytes)
11: [https://www.uniprot.org/uniprot/PRTC_DICCH PRTC_DICCH]
16: ...ptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; script "...
26: ... structure and role of amino acids Y228 and E189.,Hege T, Baumann U J Mol Biol. 2001 Nov 23;314(2):187-9...
38: [[Category: Hege T]] - 1k7i (2,399 bytes)
11: [https://www.uniprot.org/uniprot/PRTC_DICCH PRTC_DICCH]
16: ...ptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; script "...
27: [[Category: Hege T]] - 1k7q (2,398 bytes)
11: [https://www.uniprot.org/uniprot/PRTC_DICCH PRTC_DICCH]
16: ...ptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; script "...
27: [[Category: Hege T]] - User:Michael Strong/H1N1/PA (354,535 bytes)
270: ... KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
271: ... KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
272: ... KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
273: ... KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
274: ... KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300 - 3hb2 (2,510 bytes)
11: [https://www.uniprot.org/uniprot/PRTC_DICCH PRTC_DICCH]
16: ...ptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; script "...
28: [[Category: Hege T]] - 3hbu (4,419 bytes)
11: [https://www.uniprot.org/uniprot/PRTC_DICCH PRTC_DICCH]
16: ...ptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; script "...
26: ...f the zinc-binding site.,Oberholzer AE, Bumann M, Hege T, Russo S, Baumann U Biol Chem. 2009 Jun 27. PMI...
40: [[Category: Hege T]] - 3hbv (4,402 bytes)
11: [https://www.uniprot.org/uniprot/PRTC_DICCH PRTC_DICCH]
16: ...ptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; script "...
26: ...f the zinc-binding site.,Oberholzer AE, Bumann M, Hege T, Russo S, Baumann U Biol Chem. 2009 Jun 27. PMI...
40: [[Category: Hege T]] - 3hda (4,372 bytes)
2: ==PrtC methionine mutants: M226A_DESY==
11: [https://www.uniprot.org/uniprot/PRTC_DICCH PRTC_DICCH]
16: ...ptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; script "...
26: ...f the zinc-binding site.,Oberholzer AE, Bumann M, Hege T, Russo S, Baumann U Biol Chem. 2009 Jun 27. PMI...
40: [[Category: Hege T]] - Category:Hege, D (38 bytes)
1: List of pages with the keyword Hege, D - 8c0z (3,832 bytes)
16: ... protein nanowire.,Winiarska A, Ramirez-Amador F, Hege D, Gemmecker Y, Prinz S, Hochberg G, Heider J, Sz...
28: [[Category: Hege D]] - Category:Hege, T (38 bytes)
1: List of pages with the keyword Hege, T - Category:Hege T (37 bytes)
1: List of pages with the keyword Hege T - Category:Hege D (37 bytes)
1: List of pages with the keyword Hege D
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
You may also try
