Search results

From Proteopedia

You searched for Hege,_T

Jump to: navigation, search

There is no page with the exact title "Hege,_T". The search results for "Hege,_T" are displayed below. You can create a page titled Hege,_T (by clicking on the red link).

For more information about searching Proteopedia, see Help.

Showing below 19 results starting with #1.


View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

Article title matches

  1. Category:Hege, D (38 bytes)
    1: List of pages with the keyword Hege, D
  2. Category:Hege, T (38 bytes)
    1: List of pages with the keyword Hege, T
  3. Category:Hege T (37 bytes)
    1: List of pages with the keyword Hege T
  4. Category:Hege D (37 bytes)
    1: List of pages with the keyword Hege D

Page text matches

  1. 1go7 (2,443 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    22: __TOC__
    26: [[Category: Hege T]]
  2. 1jiw (4,270 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ...itor: inhibition by a zinc-NH2 coordinative bond.,Hege T, Feltzer RE, Gray RD, Baumann U J Biol Chem. 20...
    33: __TOC__
    40: [[Category: Hege T]]
  3. 1k7g (4,621 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ... structure and role of amino acids Y228 and E189.,Hege T, Baumann U J Mol Biol. 2001 Nov 23;314(2):187-9...
    33: __TOC__
    38: [[Category: Hege T]]
  4. 1k7i (2,399 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    22: __TOC__
    27: [[Category: Hege T]]
  5. 1k7q (2,398 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    22: __TOC__
    27: [[Category: Hege T]]
  6. User:Michael Strong/H1N1/PA (354,535 bytes)
    270: ... KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
    271: ... KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
    272: ... KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
    273: ... KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
    274: ... KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
  7. 3hb2 (2,510 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    22: __TOC__
    28: [[Category: Hege T]]
  8. 3hbu (4,419 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ...f the zinc-binding site.,Oberholzer AE, Bumann M, Hege T, Russo S, Baumann U Biol Chem. 2009 Jun 27. PMI...
    33: __TOC__
    40: [[Category: Hege T]]
  9. 3hbv (4,402 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ...f the zinc-binding site.,Oberholzer AE, Bumann M, Hege T, Russo S, Baumann U Biol Chem. 2009 Jun 27. PMI...
    33: __TOC__
    40: [[Category: Hege T]]
  10. 3hda (4,372 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ...f the zinc-binding site.,Oberholzer AE, Bumann M, Hege T, Russo S, Baumann U Biol Chem. 2009 Jun 27. PMI...
    33: __TOC__
    40: [[Category: Hege T]]
  11. Category:Hege, D (38 bytes)
    1: List of pages with the keyword Hege, D
  12. 8c0z (3,832 bytes)
    16: ... protein nanowire.,Winiarska A, Ramirez-Amador F, Hege D, Gemmecker Y, Prinz S, Hochberg G, Heider J, Sz...
    23: __TOC__
    28: [[Category: Hege D]]
  13. Category:Hege, T (38 bytes)
    1: List of pages with the keyword Hege, T
  14. Category:Hege T (37 bytes)
    1: List of pages with the keyword Hege T
  15. Category:Hege D (37 bytes)
    1: List of pages with the keyword Hege D

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)



Search in namespaces:

List redirects
Search for
Views
Personal tools