This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


Search results

From Proteopedia

You searched for Hege,_T

Jump to: navigation, search

There is no page with the exact title "Hege,_T". The search results for "Hege,_T" are displayed below. You can create a page titled Hege,_T (by clicking on the red link).

For more information about searching Proteopedia, see Help.

To exclude pages titled with 4-character PDB codes, use the checkbox "only Human created pages" at the bottom of this page.

Showing below 19 results starting with #1.


View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

Article title matches

  1. Category:Hege, D (38 bytes)
    1: List of pages with the keyword Hege, D
  2. Category:Hege, T (38 bytes)
    1: List of pages with the keyword Hege, T
  3. Category:Hege T (37 bytes)
    1: List of pages with the keyword Hege T
  4. Category:Hege D (37 bytes)
    1: List of pages with the keyword Hege D

Page text matches

  1. 1go7 (2,443 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    22: __TOC__
    26: [[Category: Hege T]]
  2. 1jiw (4,270 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ...itor: inhibition by a zinc-NH2 coordinative bond.,Hege T, Feltzer RE, Gray RD, Baumann U J Biol Chem. 20...
    33: __TOC__
    40: [[Category: Hege T]]
  3. 1k7g (4,621 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ... structure and role of amino acids Y228 and E189.,Hege T, Baumann U J Mol Biol. 2001 Nov 23;314(2):187-9...
    33: __TOC__
    38: [[Category: Hege T]]
  4. 1k7i (2,399 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    22: __TOC__
    27: [[Category: Hege T]]
  5. 1k7q (2,398 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    22: __TOC__
    27: [[Category: Hege T]]
  6. User:Michael Strong/H1N1/PA (354,535 bytes)
    270: ... KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
    271: ... KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
    272: ... KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
    273: ... KEVNAKIEPFLRTTPRPLKLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
    274: ... KEVNAKIEPFLRTTPRPLRLPDGPLCHQRSKFLLMDALKLSIEDPSHEGE 300
  7. 3hb2 (2,510 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    22: __TOC__
    28: [[Category: Hege T]]
  8. 3hbu (4,419 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ...f the zinc-binding site.,Oberholzer AE, Bumann M, Hege T, Russo S, Baumann U Biol Chem. 2009 Jun 27. PMI...
    33: __TOC__
    40: [[Category: Hege T]]
  9. 3hbv (4,402 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ...f the zinc-binding site.,Oberholzer AE, Bumann M, Hege T, Russo S, Baumann U Biol Chem. 2009 Jun 27. PMI...
    33: __TOC__
    40: [[Category: Hege T]]
  10. 3hda (4,372 bytes)
    16: ...criptWhenChecked>; select protein; define ~consurf_to_do selected; consurf_initial_scene = true; scrip...
    26: ...f the zinc-binding site.,Oberholzer AE, Bumann M, Hege T, Russo S, Baumann U Biol Chem. 2009 Jun 27. PMI...
    33: __TOC__
    40: [[Category: Hege T]]
  11. Category:Hege, D (38 bytes)
    1: List of pages with the keyword Hege, D
  12. 8c0z (1,906 bytes)
    11: __TOC__
    16: [[Category: Hege D]]
  13. Category:Hege, T (38 bytes)
    1: List of pages with the keyword Hege, T
  14. Category:Hege T (37 bytes)
    1: List of pages with the keyword Hege T
  15. Category:Hege D (37 bytes)
    1: List of pages with the keyword Hege D

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)



Search in namespaces:

Include only Seeded (Automatic) pages - only Human created pages
List redirects
Search for

You may also try
Views
Personal tools