Search results
From Proteopedia
You searched for Michael_Strong/H1N1/HA
There is no page with the exact title "Michael_Strong/H1N1/HA". The search results for "Michael_Strong/H1N1/HA" are displayed below. You can create a page titled Michael_Strong/H1N1/HA (by clicking on the red link).
For more information about searching Proteopedia, see Help.
Showing below 15 results starting with #1.
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
No page title matches
Page text matches
- Proteopedia:Page of the Year Entrants (2,819 bytes)
12: ...]] [[User:Mette Trauelsen]] -- [[Nitric Oxide Synthase]]
17: # [[User:Tzviya Zeev-Ben-Mordehai]] -- [[Intrinsically Disordered Protein]] (see h...
18: ...ilman Schirmer]] -- [[C-di-GMP signaling]] (Note that there are several sub-pages)
21: ...ee Mukherjee]] -- [[PHB synthase in Rhodobacter sphaeroides]]
22: # [[User:Paula Grabowski]] -- [[Triosephosphate Isomerase]] - User:Michael Strong (964 bytes)
1: Michael Strong<br>
9: '''H1N1 Swine Flu Genome and Protein Analysis:'''
10: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
16: [[User:Michael_Strong/TB|M. tuberculosis Drug Resistance Mutat... - Avian Influenza Neuraminidase, Tamiflu and Relenza (20,727 bytes)
9: ...g them to enter and infect cells. After the virus has replicated, neuraminidase (also called sialidase...
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
18: *Each of the four protein chains in the tetramer has a catalytic site, indicated in <scene name='Avia...
20: ...le protein chain, being distant from neighboring chains.
22: ...isting of several beta sheets with three short alpha helices ({{Template:ColorKey_Strand}}, {{Template... - User:Michael Strong/H1N1 (61,695 bytes)
1: '''2009 H1N1 swine flu genome and protein analysis'''
3: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
6: ...ng Multiple Sequence Alignments of newly sequence H1N1 strains, Sequence Polymorphisms, and Related Sequ...
8: ...B1, PA, HA, NP, NA, MP, and NS proteins from 2009 H1N1 strains from Mexico, California, Texas, New York,...
12: ...index.php/3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' /> - User:Michael Strong/H1N1/PB2 (362,698 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' />
64: |<scene name='User:Michael_Strong/H1N1/PB2/MSA/2/1'>G698</scene>
70: H1N1 Swine Flu Multiple Sequence Alignment of PB2 Prot...
172: gi|229892698_A/Canada-NS/RV153 HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 2... - User:Michael Strong/H1N1/PB1 (389,962 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
70: H1N1 Swine Flu Multiple Sequence Alignment of PB1 Prot...
732: ...823_1 PB1 [Influenza A virus (A/Wisconsin/10/98 (H1N1))]
1520: ...ase PB1 [Influenza A virus (A/swine/Ohio/75004/04(H1N1))]
1748: ...4969.1| polymerase PB1 [Influenza A virus (A/Nanchang/0074/94(H3N2))] - User:Michael Strong/H1N1/PA (354,535 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/3cm8 3cm8]' scene ='User:Michael_Strong/H1N1/PA/MSA/1/1'/>
24: |<scene name='User:Michael_Strong/H1N1/PA/MSA/269/2'>269</scene>
30: |<scene name='User:Michael_Strong/H1N1/PA/MSA/275/3'>275</scene>
36: |<scene name='User:Michael_Strong/H1N1/PA/MSA/581/2'>581</scene> - User:Michael Strong/H1N1/HA (303,506 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ....php/3gbn 3gbn]' scene ='User:Michael_Strong/H1N1/HA/MSA/1/1'/>
15: |HA
20: |HA
25: |HA - User:Michael Strong/H1N1/NP (283,820 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/2q06 2q06]' scene ='User:Michael_Strong/H1N1/NP/MSA/1/1'/>
24: |<scene name='User:Michael_Strong/H1N1/NP/MSA/35/1'>35</scene>
30: |<scene name='User:Michael_Strong/H1N1/NP/MSA/90/1'>90</scene>
36: |<scene name='User:Michael_Strong/H1N1/NP/MSA/106/1'>106</scene> - Influenza (3,024 bytes)
1: ...H1N1_navbox.jpg|350px|right|thumb| Picture of the H1N1 Influenza Virus]]
8: * H1N1 Sequence Analyses
9: ** [[User:Michael_Strong/H1N1|H1N1 Swine Flu Sequence Analysis]]
10: ** [[User:Michael_Strong/H1N1/MP1/MSA|H1N1 Swine Flu Multiple Sequence Alignment]]
11: ** [[User:Michael Strong/H1N1/MP2/MSA|H1N1 Sequence Alignment of MP2 Protein]] - User:Michael Strong/H1N1/NA (258,192 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/3b7e 3b7e]' scene ='User:Michael_Strong/H1N1/NA/MSA/1/1'/>
29: |<scene name='User:Michael_Strong/H1N1/NA/MSA/83/1'>83</scene>
35: |<scene name='User:Michael_Strong/H1N1/NA/MSA/95/2'>95</scene>
41: |<scene name='User:Michael_Strong/H1N1/NA/MSA/96/2'>96</scene> - User:Michael Strong/H1N1/MP (265,936 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/2rlf 2rlf]' scene ='User:Michael_Strong/H1N1/MP/1/2'/>
19: |<scene name='User:Michael_Strong/H1N1/MP/3/2'>3</scene>
34: H1N1 Swine Flu Multiple Sequence Alignment of MP1 Prot...
301: gi|227831794_A/Texas/05/2009 EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 248 - User:Michael Strong/H1N1/NS (152,680 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/3f5t 3f5t]' scene ='User:Michael_Strong/H1N1/NS1/MSA/1/1'/>
18: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/12/1'>12</scene>
24: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/32/1'>32</scene>
30: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/45/1'>45</scene> - User:Jaime Prilusky/Workbench/POTY2010 (4,243 bytes)
1: <!-- Please note that all contributions to Proteopedia are considered ...
2: You are also promising us that you wrote this yourself, or copied it from a pub...
29: ...[User:Daniel Seeman]] -- [[Alpha-1-antitrypsin]] (has an NMR format pdb in it, takes a while to load)
40: * [[User:Michael Strong]] -- [[2g38]] 0
51: ... [[User:Michael Strong]] -- [[User:Michael_Strong/H1N1]] - Sandbox hemant (20,243 bytes)
9: ...g them to enter and infect cells. After the virus has replicated, neuraminidase (also called sialidase...
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
18: *Each of the four protein chains in the tetramer has a catalytic site, indicated in <scene name='Avia...
20: ...le protein chain, being distant from neighboring chains.
22: ...isting of several beta sheets with three short alpha helices ({{Template:ColorKey_Strand}}, {{Template...
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)